Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TAGKVIKC1.1.1.1;Alcohol dehydrogenase. 15 -
GKVIKCKAA1.1.1.1;Alcohol dehydrogenase. 17 -
EVRIKIL1.1.1;With NAD(+) or NADP(+) as acceptor. 48 -
GICRTDDH1.1.1.1;Alcohol dehydrogenase. 57
  • Metal Site C=Cysteine at location 59 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
FPVIVGHEA1.1.1.1;Alcohol dehydrogenase. 74
  • Metal Site H=Histidine at location 80 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
PGDKVIPLF1.1.1;With NAD(+) or NADP(+) as acceptor. 98 -
RFTCKGK1.1.1.1;Alcohol dehydrogenase. 141 -
TSTFTEYTV1.1.1;With NAD(+) or NADP(+) as acceptor. 155 -
CLIGCGF1.1.1;With NAD(+) or NADP(+) as acceptor. 182
  • Metal Site C=Cysteine at location 182 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
GCGFSTGYG1.1.1.1;Alcohol dehydrogenase. 185
  • Metal Site C=Cysteine at location 186 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
VFGLGGVGLSVIMGCK1.1.1.1;Alcohol dehydrogenase. 209 -
AGASRII1.1.1;With NAD(+) or NADP(+) as acceptor. 226 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGD
KVIPLF
LPQCRECNACRNPDGNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGK
VKPGSTCV
VFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGT
SVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF



DME EC Prediction for this protein is: 1.1.1.1
Check another protein