Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LERLYQRYF4.6.1.1;Adenylate cyclase. 166 -
RIKILGDCYYC4.6.1.1;Adenylate cyclase. 457
  • Metal Site D=Aspartic acid at location 463 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
DHAHCCVEMG4.6.1.1;Adenylate cyclase. 477
  • Domain: Guanylate cyclase
VDMRIGIH4.6.1.1;Adenylate cyclase. 504 -
VLCGVLGLRKWQ4.6.1.1;Adenylate cyclase. 515 -
CGVLGLRKWQFDVWS4.6.1.1;Adenylate cyclase. 517
  • Domain: Guanylate cyclase
EELYSQSYD4.6.1.1;Adenylate cyclase. 971 -
ECLRLLNEII4.6.1.1;Adenylate cyclase. 1006
  • Domain: Guanylate cyclase
EKIKTIG4.6.1.1;Adenylate cyclase. 1031
  • Domain: Guanylate cyclase
TYMAVSGL4.6.1.1;Adenylate cyclase. 1039 -
SRMDSTGV4.6.1.1;Adenylate cyclase. 1119
  • Domain: Guanylate cyclase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSGSGSGGSGKASDPAGGGPNHHAPQLSGDSALPLYSLGPGERA
HSTCGTKVFPERSGSGSASGSGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRD
LERLYQRYFLGQRRKSEVVMNVLDVLTKLTLLVLH
LSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHTYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQH
QFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCL
RIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKTIRYVRSRT
KHD
VDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPED
IVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSL
EHKYSQMRDEVFKSNLVCAFIVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINETYLARNVIIFASILINFLGA
ILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTGVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKEV
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDN
EELYSQSYDAVGVMFASIPGFADFYSQTEM
NNQGV
ECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGV
IGAKKPQYDIWGKTVNLA
SRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP



DME EC Prediction for this protein is: 4.6.1.1
Check another protein