Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LCKFCDV2.7.11.30;Receptor protein serine/threonine kinase. 50
  • Gene: TGFR2
STCDNQKSC2.7.11.30;Receptor protein serine/threonine kinase. 59
  • Gene: TGFR2
SDISSTCANNINHNTELLPIELD2.7.11.30;Receptor protein serine/threonine kinase. 225
  • Gene: TGFR2
VAVKIFP2.7.11.30;Receptor protein serine/threonine kinase. 274
  • Binding Site K=Lysine at location 277 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
NLKHENILQFLTAEERKT2.7.11.30;Receptor protein serine/threonine kinase. 298
  • Domain: Protein kinase
  • Gene: TGFR2
WLITAFH2.7.11.30;Receptor protein serine/threonine kinase. 322
  • Domain: Protein kinase
GNLQEYLTRH2.7.11.30;Receptor protein serine/threonine kinase. 331
  • Domain: Protein kinase
  • Gene: TGFR2
SLARGIAHLHSDHTPCGRPK2.7.11.30;Receptor protein serine/threonine kinase. 353
  • Domain: Protein kinase
  • Gene: TGFR2
IVHRDLK2.7.11;Protein-serine/threonine kinases. 375
  • Active Site R=Arginine at location 378 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
HRDLKSSN2.7.11;Protein-serine/threonine kinases. 377
  • Active Site D=Aspartic acid at location 379 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
VKNDLTC2.7.11.30;Receptor protein serine/threonine kinase. 387
  • Domain: Protein kinase
RYMAPEVL2.7.11.30;Receptor protein serine/threonine kinase. 423
  • Domain: Protein kinase
YMAPEVL2.7.11;Protein-serine/threonine kinases. 424
  • Domain: Protein kinase
EARLTAQC2.7.11.30;Receptor protein serine/threonine kinase. 526
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETV
CHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSST
WETGKTRKLMEFSEHCAIILEDDR
SDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKT
ELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGL
SLRLDPTLSVDDLANSGQVGTA
RYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEI
PSFWLNHQGIQMVCETLTECWDHDP
EARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK



DME EC Prediction for this protein is: 2.7.11.30
Check another protein