Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TLQITCRG2.7.10.1;Receptor protein-tyrosine kinase. 48
  • Domain: Ig-like C2-type
  • Gene: VGFR2
YAGMVFCEAKI2.7.10.1;Receptor protein-tyrosine kinase. 194
  • Domain: Ig-like C2-type
  • Gene: VGFR2
VVGYRIYD2.7.10.1;Receptor protein-tyrosine kinase. 218
  • Gene: VGFR2
GNLENQTT2.7.10.1;Receptor protein-tyrosine kinase. 671
  • Domain: Ig-like C2-type
  • Gene: VGFR2
KTGYLSI2.7.10.1;Receptor protein-tyrosine kinase. 798 -
WEFPRDRL2.7.10.1;Receptor protein-tyrosine kinase. 827 -
VAVKMLK2.7.10.1;Receptor protein-tyrosine kinase. 865
  • Binding Site K=Lysine at location 868 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
KMLKEGAT2.7.10.1;Receptor protein-tyrosine kinase. 868
  • Binding Site K=Lysine at location 868 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
ALMSELK2.7.10.1;Receptor protein-tyrosine kinase. 881
  • Domain: Protein kinase
HLNVVNLLGACTK2.7.10.1;Receptor protein-tyrosine kinase. 895
  • Domain: Protein kinase
GPLMVIVE2.7.10.1;Receptor protein-tyrosine kinase. 910
  • Domain: Protein kinase
RLDSITSSQSS2.7.10.1;Receptor protein-tyrosine kinase. 962
  • Domain: Protein kinase
  • Gene: VGFR2
SLSDVEEE2.7.10.1;Receptor protein-tyrosine kinase. 982
  • Domain: Protein kinase
CYSFQVA2.7.10.1;Receptor protein-tyrosine kinase. 1007
  • Domain: Protein kinase
GMEFLASRKCIHRDLAARNILLS2.7.10.1;Receptor protein-tyrosine kinase. 1015
  • Active Site D=Aspartic acid at location 1028 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
SRKCIHRDLAARNILLSE2.7.10.1;Receptor protein-tyrosine kinase. 1021
  • Active Site D=Aspartic acid at location 1028 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 1027
  • Active Site D=Aspartic acid at location 1028 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KICDFGLARD2.7.10.1;Receptor protein-tyrosine kinase. 1043
  • Domain: Protein kinase
DFGLARDI2.7.10.1;Receptor protein-tyrosine kinase. 1046
  • Domain: Protein kinase
PDYVRKG2.7.10.1;Receptor protein-tyrosine kinase. 1057
  • Domain: Protein kinase
RLPLKWMAPE2.7.10.1;Receptor protein-tyrosine kinase. 1066
  • Domain: Protein kinase
WEIFSLG2.7.10.1;Receptor protein-tyrosine kinase. 1096
  • Domain: Protein kinase
FSLGASPYP2.7.10;Protein-tyrosine kinases. 1099
  • Domain: Protein kinase
GTRMRAP2.7.10.1;Receptor protein-tyrosine kinase. 1122
  • Domain: Protein kinase
LVEHLGNLLQA2.7.10.1;Receptor protein-tyrosine kinase. 1156
  • Domain: Protein kinase
  • Gene: VGFR2
MEEDSGLSLPTSP2.7.10.1;Receptor protein-tyrosine kinase. 1186
  • Gene: VGFR2
SKRKSRPVSVKTFEDIPL2.7.10.1;Receptor protein-tyrosine kinase. 1227
  • Gene: VGFR2
DSGMVLASEE2.7.10.1;Receptor protein-tyrosine kinase. 1259 -
SNQTSGYQSGYHSDD2.7.10.1;Receptor protein-tyrosine kinase. 1299
  • Gene: VGFR2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGA
YKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMIS
YAGMVFC
EAKI
NDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVIL
TNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVN
KNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPT
PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTIT
GNLENQTTSIGESIEVSCTASGNPPPQIMW
FKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGGEL
KTG
YLSI
VMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTK
PGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFL
TLEHLI
CYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFS
LGASPYP
GVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQN
SKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSN
QTSGYQSGYHSDD
TDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV



DME EC Prediction for this protein is: 2.7.10.1
Check another protein