Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KSPKILPDIL4.2.1.22;Cystathionine beta-synthase. 72
  • Gene: CBS
AKCEFFNAGGSVKDRI4.2.1.22;Cystathionine beta-synthase. 107
  • Gene: CBS
GYRCIIVMPEKMS4.2.1.22;Cystathionine beta-synthase. 162
  • Gene: CBS
EKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLK4.2.1.22;Cystathionine beta-synthase. 176
  • Gene: CBS
EIPNSHILDQY4.2.1.22;Cystathionine beta-synthase. 213
  • Gene: CBS
SNPLAHYD4.2.1.22;Cystathionine beta-synthase. 227
  • Gene: CBS
GTGGTITGIARKLKEKCPGC4.2.1.22;Cystathionine beta-synthase. 256
  • Gene: CBS
IIGVDPEGSILAEPEELNQTE4.2.1.22;Cystathionine beta-synthase. 277
  • Gene: CBS
LSAPLTVLPT4.2.1.22;Cystathionine beta-synthase. 419
  • Domain: CBS
  • Gene: CBS
ILGMVTLGNMLSSLLAGKV4.2.1.22;Cystathionine beta-synthase. 455
  • Domain: CBS
  • Gene: CBS
LSHILEMDHFALVVHEQIQ4.2.1.22;Cystathionine beta-synthase. 499
  • Gene: CBS

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
LKCELL
AKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSP
ESHVGVAWRLK
NEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTT
YEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEE
DLTEKKPWWWHLRVQELG
LSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLS
HILEMDHFALVVHEQIQ
YHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK



DME EC Prediction for this protein is: 4.2.1.22
Check another protein