Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DDMGWGDLG3.1.6.4;N-acetylgalactosamine-6-sulfatase. 39
  • Metal Site D=Aspartic acid at location 39 on the protein
  • Metal Site Description: Calcium (By similarity).
ANPLCSPSRAALLTGRLPIR3.1.6.4;N-acetylgalactosamine-6-sulfatase. 75
  • Metal Site C=Cysteine at location 79 on the protein
  • Metal Site Description: Calcium; via 3-oxoalanine (By
  • Gene: GALNS
PSRAALLTGRLP3.1.6;Sulfuric ester hydrolases. 81 -
DATHAPVYAS3.1.6.4;N-acetylgalactosamine-6-sulfatase. 233
  • Gene: GALNS
NTFVFFTSDNGAAL3.1.6.4;N-acetylgalactosamine-6-sulfatase. 280
  • Metal Site D=Aspartic acid at location 288 on the protein
  • Metal Site Description: Calcium (By similarity).
  • Gene: GALNS
DFCPGQNVSGVTTH3.1.6.4;N-acetylgalactosamine-6-sulfatase. 417
  • Gene: GALNS
LPLIFHLGRDPGERFPL3.1.6.4;N-acetylgalactosamine-6-sulfatase. 438
  • Gene: GALNS
AVMNWAPPGCEKLGKCLTPPES3.1.6.4;N-acetylgalactosamine-6-sulfatase. 492
  • Gene: GALNS

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAVVAATRWWQLLLVLSAAGMGASGAPQPPNILLLLMDDMGWGDLGVYGEPSRETPNLDRMAAEGLLFPNFYSANPLCSPSRAALLTGRLPIRNGFYTT
NAHARNAYTPQEIVGGIPDSEQLLPELLKKAGYVSKIVGKWHLGHRPQFHPLKHGFDEWFGSPNCHFGPYDNKARPNIPVYRDWEMVGRYYEEFPINLKT
GEANLTQIYLQEALDFIKRQARHHPFFLYWAV
DATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQG
GSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSLALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKA
HFWTWTNSWENFRQGI
DFCPGQNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPG
CEKLGKCLTPPES
IPKKCLWSH



DME EC Prediction for this protein is: 3.1.6.4
Check another protein