Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FSCEAHN2.7.10.1;Receptor protein-tyrosine kinase. 203
  • Domain: Ig-like C2-type
KVAVKTMK2.7.10;Protein-tyrosine kinases. 563
  • Binding Site K=Lysine at location 563 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 671
  • Active Site D=Aspartic acid at location 672 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
GDYYRQG2.7.10.1;Receptor protein-tyrosine kinase. 700
  • Domain: Protein kinase
TSKSDVW2.7.10;Protein-tyrosine kinases. 727
  • Domain: Protein kinase
KSDVWSFG2.7.10;Protein-tyrosine kinases. 729
  • Domain: Protein kinase
FGVTMWEIATRG2.7.10.1;Receptor protein-tyrosine kinase. 735
  • Domain: Protein kinase
TRGQTPY2.7.10.1;Receptor protein-tyrosine kinase. 744
  • Domain: Protein kinase
GNRLKQP2.7.10.1;Receptor protein-tyrosine kinase. 765
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVS
QLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRSLHVPGLNKT
SS
FSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSNDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLH
PHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVS
NLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRV
RKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSIL
KVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRL
IGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLVKFMADIASGMEYLSTKRFIH
RDLAARNCMLNENMSVCVADFGLSKKIYNG
DYYRQG
RIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTELR
EDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA



DME EC Prediction for this protein is: 2.7.10.1
Check another protein