Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QWGDEGK6.3.4.4;Adenylosuccinate synthase. 37
  • Metal Site D=Aspartic acid at location 40 on the protein
  • Metal Site Description: Magnesium (By similarity).
GDEGKGK6.3.4.4;Adenylosuccinate synthase. 39
  • Metal Site D=Aspartic acid at location 40 on the protein
  • Metal Site Description: Magnesium (By similarity).
GGNNAGH6.3.4.4;Adenylosuccinate synthase. 62
  • Metal Site G=Glycine at location 67 on the protein
  • Metal Site Description: Magnesium; via carbonyl oxygen
NAGHTVV6.3.4.4;Adenylosuccinate synthase. 65
  • Metal Site G=Glycine at location 67 on the protein
  • Metal Site Description: Magnesium; via carbonyl oxygen
EYDFHLLPSGIIN6.3.4.4;Adenylosuccinate synthase. 76 -
FIGNGVV6.3.4.4;Adenylosuccinate synthase. 94 -
HLPGLFEEAEKN6.3.4.4;Adenylosuccinate synthase. 102 -
GTTKKGIGP6.3.4.4;Adenylosuccinate synthase. 160 -
YSSKAAR6.3.4.4;Adenylosuccinate synthase. 170
  • Active Site K=Lysine at location 173 on the protein
  • Active Site Description: By similarity.
PMVRDGVYF6.3.4.4;Adenylosuccinate synthase. 229 -
YEALHGPPKK6.3.4.4;Adenylosuccinate synthase. 239 -
YPFVTSS6.3.4.4;Adenylosuccinate synthase. 266 -
TVGGVCTGLG6.3.4.4;Adenylosuccinate synthase. 275 -
KAYTTRVG6.3.4.4;Adenylosuccinate synthase. 298 -
TGRKRRCGW6.3.4.4;Adenylosuccinate synthase. 332 -
RRCGWLD6.3.4.4;Adenylosuccinate synthase. 336 -
NGFTALALTKLDILD6.3.4.4;Adenylosuccinate synthase. 353 -
EIKVGVAYKL6.3.4.4;Adenylosuccinate synthase. 371 -
PANQEVLNKVEVQYKTLPGWNTDISNAR6.3.4.4;Adenylosuccinate synthase. 389
  • Gene: PURA2
LPVNAQNY6.3.4.4;Adenylosuccinate synthase. 421 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVV
IHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLAN
QYKSIYPTLEIDIEGELQKLKGYMEKIK
PMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY
TTRVG
IGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEV
QYKTLPGWNTDISNAR
AFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF



DME EC Prediction for this protein is: 6.3.4.4
Check another protein