Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VAKFCYADK1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 91
  • Gene: AL4A1
QAEIDAAAE1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 157 -
ELIDFFRFNAK1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 165
  • Gene: AL4A1
YRGLEGFVAA1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 197
  • Gene: AL4A1
PFNFTAI1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 209 -
PALMGNVVLWKPSDTAM1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 223
  • Gene: AL4A1
GLPPNIIQFVPADGP1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 253
  • Gene: AL4A1
FGDTVTSSEHL1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 269
  • Gene: AL4A1
GINFTGSVPTFK1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 281
  • Gene: AL4A1
LWKQVAQNLD1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 294
  • Gene: AL4A1
AGECGGKNFHFVH1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 312
  • Active Site E=Glutamic acid at location 314 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Gene: AL4A1
GQKCSACSR1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 345
  • Active Site C=Cysteine at location 348 on the protein
  • Active Site Description: Nucleophile (By similarity).
SLWPQIKGRLLEE1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 359
  • Gene: AL4A1
TFFSAVID1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 386
  • Gene: AL4A1
WLEHARSSP1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 403
  • Gene: AL4A1
PIMKEEIFGPVL1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 442
  • Gene: AL4A1
YINDKSTGS1.5.1.12;1-pyrroline-5-carboxylate dehydrogenase. 505
  • Gene: AL4A1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKS
LLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVI
QAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL
EGFVAA
ISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQ
NLD
RFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARI
KK
WLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNA
AGNF
YINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ



DME EC Prediction for this protein is: 1.5.1.12
Check another protein