Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QEPGPPCGLGLGLGLGLCGKQGPA1.14.13.39;Nitric-oxide synthase. 9
  • Gene: NOS3
EPSRAPA1.14.13.39;Nitric-oxide synthase. 37
  • Gene: NOS3
GSITYDTL1.14.13.39;Nitric-oxide synthase. 77
  • Gene: NOS3
QYYSSIKR1.14.13.39;Nitric-oxide synthase. 133 -
EVAATGTY1.14.13.39;Nitric-oxide synthase. 156 -
AWRNAPRC1.14.13.39;Nitric-oxide synthase. 177 -
LQVFDAR1.14.13.39;Nitric-oxide synthase. 193 -
ICNHIKYATN1.14.13.39;Nitric-oxide synthase. 211 -
GNLRSAIT1.14.13.39;Nitric-oxide synthase. 222 -
RSAITVFPQR1.14.13.39;Nitric-oxide synthase. 225 -
GDPANVE1.14.13.39;Nitric-oxide synthase. 263 -
RFDVLPLLLQA1.14.13.39;Nitric-oxide synthase. 285 -
PPELVLEVP1.14.13.39;Nitric-oxide synthase. 306 -
LGLRWYALPAVS1.14.13.39;Nitric-oxide synthase. 326 -
LPAVSNMLLEIGGLEF1.14.13.39;Nitric-oxide synthase. 333 -
AVLHSYQ1.14.13.39;Nitric-oxide synthase. 405 -
VTIVDHH1.14.13.39;Nitric-oxide synthase. 415 -
SFMKHLE1.14.13.39;Nitric-oxide synthase. 426 -
RGGCPADW1.14.13.39;Nitric-oxide synthase. 438 -
TPVFHQEM1.14.13.39;Nitric-oxide synthase. 457 -
RKKTFKEVANAVKISASLM1.14.13.39;Nitric-oxide synthase. 492
  • Gene: NOS3
MAKRVKATILY1.14.13.39;Nitric-oxide synthase. 514 -
VVTSTFGNGD1.14.13.39;Nitric-oxide synthase. 569
  • Domain: Flavodoxin-like
STFGNGDPPENG1.14.13.39;Nitric-oxide synthase. 572
  • Domain: Flavodoxin-like
VFGLGSR1.14.13.39;Nitric-oxide synthase. 649
  • Domain: Flavodoxin-like
YPHFCAF1.14.13.39;Nitric-oxide synthase. 657
  • Domain: Flavodoxin-like
GQEEAFR1.14.13.39;Nitric-oxide synthase. 690
  • Domain: Flavodoxin-like
GWAQAAFQA1.14.13.39;Nitric-oxide synthase. 697
  • Domain: Flavodoxin-like
  • Gene: NOS3
ETFCVGEDAKAAARDIFSPKR1.14.13.39;Nitric-oxide synthase. 708
  • Gene: NOS3
HVHRRKMFQAT1.14.13.39;Nitric-oxide synthase. 752
  • Gene: NOS3
LQYQPGDH1.14.13.39;Nitric-oxide synthase. 791
  • Domain: FAD-binding FR-type
GLVEALLSRVEDP1.14.13.39;Nitric-oxide synthase. 808
  • Domain: FAD-binding FR-type
  • Gene: NOS3
LLQPRYYS1.14.13.39;Nitric-oxide synthase. 934
  • Domain: FAD-binding FR-type
EIHLTVA1.14.13.39;Nitric-oxide synthase. 952
  • Domain: FAD-binding FR-type
AVLAYRTQDGLGPLHYGVCSTW1.14.13.39;Nitric-oxide synthase. 958
  • Domain: FAD-binding FR-type
  • Gene: NOS3
GDPVPCFIR1.14.13.39;Nitric-oxide synthase. 986
  • Domain: FAD-binding FR-type
  • Gene: NOS3
MTLVFGCR1.14.13.39;Nitric-oxide synthase. 1042 -
PKTYVQD1.14.13.39;Nitric-oxide synthase. 1084 -
LRTELAAEVHRVLCLE1.14.13.39;Nitric-oxide synthase. 1092
  • Gene: NOS3
VCGDVTMA1.14.13.39;Nitric-oxide synthase. 1113 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCL
GSLVFPRKLQGRPSPGPPAPEQLLSQARDFIN
QYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARD
CRSAQEMFTY
ICNHIKYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPP
ELFLL
PPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAV
EINV
AVLHSYQLAKVTIVDHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWKGSAAKGTGITRKKTFKEVA
NAVKISASLM
GTVMAKRVKATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFC
VFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQ
AAFQA
ACETFCVGEDAKAAARDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATILVRLDTGGQEGLQYQPGDHIG
VCPPNRP
GLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGPPPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLP
LLQPRYYSVSSAPSTHPGEIHLTVAVLAYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFR
LPPDPSLPCILVGPGTGIAPFRGFWQERLHDIESKGLQPTP
MTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSREPDNPKTYVQDILRTELAAEV
HRVLCLE
RGHMFVCGDVTMATNVLQTVQRILATEGDMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT
NSP



DME EC Prediction for this protein is: 1.14.13.39
Check another protein