Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GPEMVRGQ2.7.11.24;Mitogen-activated protein kinase. 10
  • Gene: MK01
FDVGPRY2.7.11.24;Mitogen-activated protein kinase. 19 -
YIGEGAYGMV2.7.11.24;Mitogen-activated protein kinase. 30
  • Domain: Protein kinase
RVAIKKI2.7.11;Protein-serine/threonine kinases. 50
  • Binding Site K=Lysine at location 54 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
RVAIKKISPFEHQT2.7.11.24;Mitogen-activated protein kinase. 50
  • Binding Site K=Lysine at location 54 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
RTLREIK2.7.11.24;Mitogen-activated protein kinase. 67
  • Domain: Protein kinase
ILLRFRHEN2.7.11.24;Mitogen-activated protein kinase. 74
  • Domain: Protein kinase
IEQMKDV2.7.11;Protein-serine/threonine kinases. 95
  • Domain: Protein kinase
DVYIVQDLMETDLYKLLK2.7.11.24;Mitogen-activated protein kinase. 100
  • Domain: Protein kinase
YQILRGLKY2.7.11.24;Mitogen-activated protein kinase. 131
  • Domain: Protein kinase
GLKYIHSA2.7.11.24;Mitogen-activated protein kinase. 136
  • Domain: Protein kinase
LKYIHSA2.7.11;Protein-serine/threonine kinases. 137
  • Domain: Protein kinase
HSANVLHRDL2.7.11.24;Mitogen-activated protein kinase. 141
  • Active Site D=Aspartic acid at location 149 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
VLHRDLK2.7.11;Protein-serine/threonine kinases. 145
  • Active Site D=Aspartic acid at location 149 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
HRDLKPSNLLLN2.7.11.24;Mitogen-activated protein kinase. 147
  • Active Site D=Aspartic acid at location 149 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
LKICDFG2.7.11;Protein-serine/threonine kinases. 163
  • Domain: Protein kinase
LKICDFGLAR2.7.11.24;Mitogen-activated protein kinase. 163
  • Domain: Protein kinase
TEYVATRWYRAPE2.7.11.24;Mitogen-activated protein kinase. 185
  • Domain: Protein kinase
YVATRWYR2.7.11;Protein-serine/threonine kinases. 187
  • Domain: Protein kinase
TRWYRAPE2.7.11;Protein-serine/threonine kinases. 190
  • Domain: Protein kinase
YRAPEIML2.7.11.24;Mitogen-activated protein kinase. 193
  • Domain: Protein kinase
DIWSVGCI2.7.11;Protein-serine/threonine kinases. 210
  • Domain: Protein kinase
WSVGCIL2.7.11;Protein-serine/threonine kinases. 212
  • Domain: Protein kinase
WSVGCILAE2.7.11.24;Mitogen-activated protein kinase. 212
  • Domain: Protein kinase
GCILAEM2.7.11;Protein-serine/threonine kinases. 215
  • Domain: Protein kinase
FPGKHYLDQLN2.7.11.24;Mitogen-activated protein kinase. 228
  • Domain: Protein kinase
NHILGIL2.7.11;Protein-serine/threonine kinases. 238
  • Domain: Protein kinase
KALDLLDKMLTFNPHKRIEVE2.7.11.24;Mitogen-activated protein kinase. 285
  • Domain: Protein kinase
  • Gene: MK01
ALAHPYLEQYYDP2.7.11.24;Mitogen-activated protein kinase. 307
  • Domain: Protein kinase
AEAPFKF2.7.11.24;Mitogen-activated protein kinase. 325
  • Gene: MK01
MELDDLPKE2.7.11.24;Mitogen-activated protein kinase. 333 -
DDLPKEKLKELI2.7.11.24;Mitogen-activated protein kinase. 336 -
ETARFQPG2.7.11.24;Mitogen-activated protein kinase. 350 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKD
VYIVQDLMETDLYKLLK
TQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIML
NSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVE
QALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS



DME EC Prediction for this protein is: 2.7.11.24
Check another protein