Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
EEVEVAPP1.1.1.1;Alcohol dehydrogenase. 25 -
EVAPPKA1.1.1.1;Alcohol dehydrogenase. 28 -
LGHEGAGIVES1.1.1.1;Alcohol dehydrogenase. 67
  • Metal Site H=Histidine at location 69 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
RFTCKGK1.1.1.1;Alcohol dehydrogenase. 130 -
PLEKVCL1.1.1.1;Alcohol dehydrogenase. 166 -
AKVTPGS1.1.1;With NAD(+) or NADP(+) as acceptor. 188 -
CAVFGLGGVGLS1.1.1.1;Alcohol dehydrogenase. 196 -
VMGCKAAGA1.1.1.1;Alcohol dehydrogenase. 209 -
KPIQEVL1.1.1.1;Alcohol dehydrogenase. 249 -
KGSVFGG1.1.1;With NAD(+) or NADP(+) as acceptor. 316 -
DPLITHTL1.1.1.1;Alcohol dehydrogenase. 344 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MCTTGQVIRCKAAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCG
ECTSCLNSEGNFCIQFKQSKTQLMSDGTS
RFTCKGKSIYHFGNTSTFCEYTVIKEISVAKIDAVAPLEKVCLISCGFSTGFGAAINTAKVTPGSTCAVFG
LGGVGLS
VVMGCKAAGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVLAAALASCNESYGVCVVVGVLPASV
QLKISGQLFFSGRSL
KGSVFGGWKSRQHIPKLVADYMAEKLNLDPLITHTLNLDKINEAVELMKTGKW



DME EC Prediction for this protein is: 1.1.1.1
Check another protein