Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TEPGAGSD1.3.99;With other acceptors. 173
  • Binding Site S=Serine at location 179 on the protein
  • Binding site description: Substrate; via carbonyl oxygen
KGRKLHK1.3.99.13;Long-chain-acyl-CoA dehydrogenase. 244
  • Gene: ACADL
EFMFEETRNYV1.3.99.13;Long-chain-acyl-CoA dehydrogenase. 304
  • Gene: ACADL

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIRRIFSPEHDIFRKSVRKFFQEEVIPHHSEWEKAGEVSREVWEKAGKQGLLG
VNIAEHLGGIGGDLYSAAIVWEEQAYSNCSGPGFSIHSGIVMSYITNHGSEEQIKHFIPQMTAGKCIGAIAM
TEPGAGSDLQGIKTNAKKDGSDWILNGS
KVFISNGSLSDVVIVVAVTNHEAPSPAHGISLFLVENGMKGFI
KGRKLHKMGLKAQDTAELFFEDIRLPASALLGEENKGFYYIMKELPQERLLIADVAI
SAS
EFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAELKTHICVTRAFVDNCLQLHEAKRLDSATACMAKYWASELQNSVAYDCVQLHGGWGYMWEYPIAK
AYVDARVQPIYGGTNEIMKELIAREIVFDK



DME EC Prediction for this protein is: 1.3.99.13
Check another protein