Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LYEDPPDQKTS4.2.99.18;DNA-(apurinic or apyrimidinic site) lyase. 44
  • Gene: APEX1
LKICSWNV4.2.99.18;DNA-(apurinic or apyrimidinic site) lyase. 62
  • Metal Site N=Asparagine at location 68 on the protein
  • Metal Site Description: Magnesium or manganese (By sim
LASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQE4.2.99.18;DNA-(apurinic or apyrimidinic site) lyase. 199
  • Metal Site D=Aspartic acid at location 210 on the protein
  • Metal Site Description: Magnesium or manganese (By sim
  • Gene: APEX1
DSFRHLYPNT4.2.99.18;DNA-(apurinic or apyrimidinic site) lyase. 251
  • Gene: APEX1
AYTFWTYM4.2.99.18;DNA-(apurinic or apyrimidinic site) lyase. 263 -
NVGWRLDY4.2.99.18;DNA-(apurinic or apyrimidinic site) lyase. 277 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCS
ENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKG
LA
SRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQE
RQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKI
RSKALGSDHCPITLYLAL



DME EC Prediction for this protein is: 4.2.99.18
Check another protein