Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RIAQNFGLQHLSSGH2.7.4.3;Adenylate kinase. 24
  • Binding Site S=Serine at location 36 on the protein
  • Binding site description: AMP (By similarity).
  • Gene: KAD4
WLLDGFPR2.7.4;Phosphotransferases with a phosphate group as acceptor. 85 -
LDGFPRT2.7.4;Phosphotransferases with a phosphate group as acceptor. 87 -
SGRVYNLDFNPP2.7.4.3;Adenylate kinase. 132
  • Gene: KAD4
DDVTGEPL2.7.4.3;Adenylate kinase. 149 -
TGEPLVQQEDDKPEA2.7.4.3;Adenylate kinase. 152
  • Gene: KAD4
AKPVIELYKSRGVLHQFSGTETN2.7.4.3;Adenylate kinase. 178
  • Gene: KAD4
FSGTETN2.7.4;Phosphotransferases with a phosphate group as acceptor. 194 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEAL
DKICEVDLVISLNIPFETLKDRLSRRWIHPP
SGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETN
KIWPYVYTLFSNKITPIQSKEAY



DME EC Prediction for this protein is: 2.7.4.3
Check another protein