Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KLAFAVFLISCSS2.7.11.30;Receptor protein serine/threonine kinase. 6
  • Gene: AVR2A
CYGDKDKRRHCFATWKNIS2.7.11.30;Receptor protein serine/threonine kinase. 50
  • Gene: AVR2A
HCFATWKNISGSIEIVKQGCWLDDINCY2.7.11.30;Receptor protein serine/threonine kinase. 59
  • Gene: AVR2A
FCCCEGN2.7.11.30;Receptor protein serine/threonine kinase. 102 -
PEMEVTQPTSNPVT2.7.11.30;Receptor protein serine/threonine kinase. 118
  • Gene: AVR2A
LLYSLVP2.7.11.30;Receptor protein serine/threonine kinase. 140
  • Gene: AVR2A
AYPPVLVPTQDPGPPPPSPL2.7.11.30;Receptor protein serine/threonine kinase. 167
  • Gene: AVR2A
GLKPLQLL2.7.11.30;Receptor protein serine/threonine kinase. 188 -
KARGRFGCVWKA2.7.11.30;Receptor protein serine/threonine kinase. 198
  • Domain: Protein kinase
VAVKIFP2.7.11.30;Receptor protein serine/threonine kinase. 216
  • Binding Site K=Lysine at location 219 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
QDKQSWQ2.7.11.30;Receptor protein serine/threonine kinase. 224
  • Domain: Protein kinase
SWQNEYE2.7.11.30;Receptor protein serine/threonine kinase. 228
  • Domain: Protein kinase
  • Gene: AVR2A
PGMKHEN2.7.11.30;Receptor protein serine/threonine kinase. 239
  • Domain: Protein kinase
FIGAEKRGT2.7.11.30;Receptor protein serine/threonine kinase. 249
  • Domain: Protein kinase
  • Gene: AVR2A
WLITAFH2.7.11.30;Receptor protein serine/threonine kinase. 264
  • Domain: Protein kinase
LKANVVSWNELC2.7.11.30;Receptor protein serine/threonine kinase. 279
  • Domain: Protein kinase
  • Gene: AVR2A
LHEDIPGLKDGHKPA2.7.11.30;Receptor protein serine/threonine kinase. 303
  • Domain: Protein kinase
  • Gene: AVR2A
HRDIKSKN2.7.11;Protein-serine/threonine kinases. 320
  • Active Site D=Aspartic acid at location 322 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KSKNVLL2.7.11.30;Receptor protein serine/threonine kinase. 324
  • Domain: Protein kinase
RYMAPEVL2.7.11.30;Receptor protein serine/threonine kinase. 364
  • Domain: Protein kinase
YMAPEVL2.7.11;Protein-serine/threonine kinases. 365
  • Domain: Protein kinase
AFLRIDMYAMGLVLWEL2.7.11.30;Receptor protein serine/threonine kinase. 381
  • Domain: Protein kinase
GLVLWELASRCTA2.7.11.30;Receptor protein serine/threonine kinase. 391
  • Domain: Protein kinase
  • Gene: AVR2A
AADGPVDEY2.7.11.30;Receptor protein serine/threonine kinase. 403
  • Domain: Protein kinase
EEIGQHPSLE2.7.11.30;Receptor protein serine/threonine kinase. 417
  • Domain: Protein kinase
QEVVVHKK2.7.11.30;Receptor protein serine/threonine kinase. 429
  • Domain: Protein kinase
TIEECWDHDAEARLSAGC2.7.11.30;Receptor protein serine/threonine kinase. 457
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEV
Y
FCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGPPPPSPLLGLKPLQLLEVKAR
GRFGCVWKA
QLLNEYVAVKIFPIQDKQSWQNEYEVYSLPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AY
LHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASR
CTAADGPVDEY
MLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNIITTEDIVTVVTM
VTNVDFPPKESSL



DME EC Prediction for this protein is: 2.7.11.30
Check another protein