Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
CPGHFGH2.7.7.6;DNA-directed RNA polymerase. 81
  • Metal Site C=Cysteine at location 81 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
LAKPVFH2.7.7.6;DNA-directed RNA polymerase. 90
  • Gene: RPB1
LQFHVAT2.7.7.6;DNA-directed RNA polymerase. 310
  • Gene: RPB1
RLKGKEGR2.7.7.6;DNA-directed RNA polymerase. 342 -
RGNLMGKRVD2.7.7.6;DNA-directed RNA polymerase. 351 -
GKRVDFS2.7.7.6;DNA-directed RNA polymerase. 356 -
FSARTVI2.7.7.6;DNA-directed RNA polymerase. 361 -
GYKVERH2.7.7.6;DNA-directed RNA polymerase. 443
  • Gene: RPB1
NADFDGD2.7.7.6;DNA-directed RNA polymerase. 493
  • Metal Site D=Aspartic acid at location 495 on the protein
  • Metal Site Description: Magnesium 1; catalytic (By sim
DFDGDEMN2.7.7.6;DNA-directed RNA polymerase. 495
  • Metal Site D=Aspartic acid at location 495 on the protein
  • Metal Site Description: Magnesium 1; catalytic (By sim
GFVENSYL2.7.7.6;DNA-directed RNA polymerase. 821
  • Gene: RPB1
EFFFHAM2.7.7.6;DNA-directed RNA polymerase. 835 -
GREGLIDTA2.7.7.6;DNA-directed RNA polymerase. 843 -
ETGYIQRRL2.7.7.6;DNA-directed RNA polymerase. 856
  • Gene: RPB1
VGALAAQS2.7.7.6;DNA-directed RNA polymerase. 1087
  • Gene: RPB1
TQMTLNTFH2.7.7.6;DNA-directed RNA polymerase. 1100 -
TFHYAGV2.7.7.6;DNA-directed RNA polymerase. 1106 -
KNVTLGVPRL2.7.7.6;DNA-directed RNA polymerase. 1115 -
GSYVNYRH2.7.7.6;DNA-directed RNA polymerase. 1390
  • Gene: RPB1
CSFEETV2.7.7.6;DNA-directed RNA polymerase. 1430 -
YSPTSPNY2.7.7.6;DNA-directed RNA polymerase. 1629
  • Gene: RPB1
YSPTSPNY2.7.7.6;DNA-directed RNA polymerase. 1741
  • Gene: RPB1
YSPTSPNY2.7.7.6;DNA-directed RNA polymerase. 1748
  • Gene: RPB1
YSPTSPNY2.7.7.6;DNA-directed RNA polymerase. 1769
  • Gene: RPB1
SPSYSPSSP2.7.7.6;DNA-directed RNA polymerase. 1801
  • Gene: RPB1
SPSYSPSSP2.7.7.6;DNA-directed RNA polymerase. 1822
  • Gene: RPB1
SPSYSPSSP2.7.7.6;DNA-directed RNA polymerase. 1843
  • Gene: RPB1
TSPKYSPTSP2.7.7.6;DNA-directed RNA polymerase. 1856
  • Gene: RPB1
TSPKYSPTSP2.7.7.6;DNA-directed RNA polymerase. 1863
  • Gene: RPB1
TSPKYSPTSP2.7.7.6;DNA-directed RNA polymerase. 1870
  • Gene: RPB1
TSPKYSPTSP2.7.7.6;DNA-directed RNA polymerase. 1905
  • Gene: RPB1
TSPKYSPTSP2.7.7.6;DNA-directed RNA polymerase. 1919
  • Gene: RPB1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFL
VKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYA
EWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKL
LQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNID
RLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQT
GYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDE
MN
LHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQ
DIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPF
GFKHRTLPHFIKDDYGPESR
GFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRL
PSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEM
VGALAAQSLGEPAT
QMTLNTFHYAGV
SAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQG
IEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFD
GSYVNYRHLAL
LCDTMTCRGHLMAITRHGVNRQDTGPLMK
CSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAY
EPRSPGGYTPQSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYS
PTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSP
VYTP
TSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN



DME EC Prediction for this protein is: 2.7.7.6
Check another protein