Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PRCGVPD3.4.24;Metalloendopeptidases. 78
  • Metal Site C=Cysteine at location 80 on the protein
  • Metal Site Description: Zinc; in inhibited form (By si
RNRQKRFVLSGGRW3.4.24;Metalloendopeptidases. 92
  • Gene: MMP11
KVWSDVTPL3.4.24.24;Gelatinase A. 135 -
VWSDVTPL3.4.24;Metalloendopeptidases. 136 -
VAAHEFGH3.4.24;Metalloendopeptidases. 212
  • Active Site E=Glutamic acid at location 216 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 215 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
FDAVSTIRGELFFFK3.4.24;Metalloendopeptidases. 298
  • Domain: Hemopexin-like
  • Gene: MMP11
GYPALASRHW3.4.24;Metalloendopeptidases. 327
  • Domain: Hemopexin-like
  • Gene: MMP11

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAPAAWLRSAAARALLPPMLLLLLQPPPLLARALPPDAHHLHAERRGPQPWHAALPSSPAPAPATQEAPRPASSLRPPRCGVPDPSDGLSARNRQKRFVL
SGGRW
EKTDLTYRILRFPWQLVQEQVRQTMAEALKVWSDVTPLTFTEVHEGRADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTHREGDVHFDYDETWT
IGDDQGTDLLQ
VAAHEFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
VSTIRGELFFFK
AGFVWRLRGGQLQPGYPALASRHWQGLPSPVDAAFEDAQGHIWFFQGAQYWVYDGEKPVLGPAPLTELGLVRFPVHAALVWGPEKNKI
YFFRGRDYWRFHPSTRRVDSPVPRRATDWRGVPSEIDAAFQDADGYAYFLRGRLYWKFDPVKVKALEGFPRLVGPDFFGCAEPANTFL



DME EC Prediction for this protein is: 3.4.24.24
Check another protein