Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRE3.3.1.1;Adenosylhomocysteinase. 3
  • Gene: SAHH
YSASKPLKG3.3.1.1;Adenosylhomocysteinase. 39
  • Gene: SAHH
PLKGARI3.3.1.1;Adenosylhomocysteinase. 44 -
GARIAGCLHMT3.3.1.1;Adenosylhomocysteinase. 47 -
SCNIFSTQ3.3.1.1;Adenosylhomocysteinase. 78 -
AWKGETDEEY3.3.1.1;Adenosylhomocysteinase. 101 -
WCIEQTL3.3.1.1;Adenosylhomocysteinase. 112
  • Gene: SAHH
NMILDDGGD3.3.1.1;Adenosylhomocysteinase. 126
  • Binding Site D=Aspartic acid at location 131 on the protein
  • Binding site description: Substrate (By similarity).
LDDGGDLT3.3.1.1;Adenosylhomocysteinase. 129
  • Binding Site D=Aspartic acid at location 131 on the protein
  • Binding site description: Substrate (By similarity).
EETTTGV3.3.1.1;Adenosylhomocysteinase. 155
  • Binding Site E=Glutamic acid at location 156 on the protein
  • Binding site description: Substrate (By similarity).
LKVPAIN3.3.1.1;Adenosylhomocysteinase. 173
  • Gene: SAHH
NVNDSVTK3.3.1.1;Adenosylhomocysteinase. 179 -
TKSKFDNLYGCRESL3.3.1.1;Adenosylhomocysteinase. 185
  • Binding Site K=Lysine at location 186 on the protein
  • Binding site description: Substrate (By similarity).
DGIKRATD3.3.1.1;Adenosylhomocysteinase. 201 -
IKRATDVM3.3.1.1;Adenosylhomocysteinase. 203 -
RATDVMIAGK3.3.1.1;Adenosylhomocysteinase. 205 -
AGKVAVV3.3.1.1;Adenosylhomocysteinase. 212 -
AVVAGYGDVGKG3.3.1.1;Adenosylhomocysteinase. 216 -
GYGDVGKGCA3.3.1.1;Adenosylhomocysteinase. 220 -
GARVIITE3.3.1.1;Adenosylhomocysteinase. 236 -
ITEIDPI3.3.1.1;Adenosylhomocysteinase. 241 -
DPINALQA3.3.1.1;Adenosylhomocysteinase. 245 -
ALQAAMEG3.3.1.1;Adenosylhomocysteinase. 249 -
EGNIFVT3.3.1.1;Adenosylhomocysteinase. 268 -
IFVTTTG3.3.1.1;Adenosylhomocysteinase. 271 -
CNIGHFD3.3.1.1;Adenosylhomocysteinase. 297 -
GHFDVEI3.3.1.1;Adenosylhomocysteinase. 300
  • Gene: SAHH
DVKWLNENAV3.3.1.1;Adenosylhomocysteinase. 307 -
NIKPQVD3.3.1.1;Adenosylhomocysteinase. 320 -
KPQVDRY3.3.1.1;Adenosylhomocysteinase. 322 -
EGRLVNL3.3.1.1;Adenosylhomocysteinase. 341 -
GRLVNLG3.3.1.1;Adenosylhomocysteinase. 342 -
GHPSFVMSNSF3.3.1.1;Adenosylhomocysteinase. 352 -
AQIELWT3.3.1.1;Adenosylhomocysteinase. 368 -
LPKKLDE3.3.1.1;Adenosylhomocysteinase. 386 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVY
AWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLI
DGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAV
EKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
KLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY



DME EC Prediction for this protein is: 3.3.1.1
Check another protein