Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
REAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHG2.7.11.1;Non-specific serine/threonine protein kinase. 19
  • Gene: KS6B1
LGKGGYG2.7.11.1;Non-specific serine/threonine protein kinase. 97
  • Domain: Protein kinase
KGGYGKVF2.7.11.1;Non-specific serine/threonine protein kinase. 99
  • Domain: Protein kinase
AKDTAHT2.7.11.1;Non-specific serine/threonine protein kinase. 134
  • Domain: Protein kinase
YAFQTGGKLYLILE2.7.11.1;Non-specific serine/threonine protein kinase. 160
  • Domain: Protein kinase
EDTACFYLAEI2.7.11.1;Non-specific serine/threonine protein kinase. 192
  • Domain: Protein kinase
GIIYRDLK2.7.11;Protein-serine/threonine kinases. 213
  • Active Site D=Aspartic acid at location 218 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLKPEN2.7.11;Protein-serine/threonine kinases. 217
  • Active Site D=Aspartic acid at location 218 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KLTDFGL2.7.11;Protein-serine/threonine kinases. 233
  • Domain: Protein kinase
KLTDFGLCKESIH2.7.11.1;Non-specific serine/threonine protein kinase. 233
  • Domain: Protein kinase
DFGLCKE2.7.11;Protein-serine/threonine kinases. 236
  • Domain: Protein kinase
FCGTIEYMAP2.7.11.1;Non-specific serine/threonine protein kinase. 253
  • Domain: Protein kinase
YMAPEIL2.7.11;Protein-serine/threonine kinases. 259
  • Domain: Protein kinase
GHNRAVDWWSLGALMYDMLTG2.7.11.1;Non-specific serine/threonine protein kinase. 269
  • Domain: Protein kinase
LQSEEDVSQFD2.7.11.1;Non-specific serine/threonine protein kinase. 373
  • Domain: AGC-kinase C-termina
SEEDVSQ2.7.11;Protein-serine/threonine kinases. 375
  • Domain: AGC-kinase C-termina
FTRQTPVDSPDD2.7.11.1;Non-specific serine/threonine protein kinase. 386
  • Domain: AGC-kinase C-termina
FLGFTYVAPSVL2.7.11.1;Non-specific serine/threonine protein kinase. 408
  • Domain: AGC-kinase C-termina
SGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL2.7.11.1;Non-specific serine/threonine protein kinase. 489
  • Gene: KS6B1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKG
GYGKVF
QVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLA
EI
SMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPL
LQSEEDVSQFDSKFTRQTPVDSPDDSTL
SESANQV
FLGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQ
PNSGPYKKQAFPMISKRPEHLRMNL



DME EC Prediction for this protein is: 2.7.11.1
Check another protein