Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LRRGLFYIHGGGWC3.1.1;Carboxylic ester hydrolases. 103
  • Active Site H=Histidine at location 111 on the protein
  • Active Site Description: Potential.
  • Gene: AAAD
GDSAGGNL3.1.1.79;Hormone-sensitive lipase. 187
  • Active Site S=Serine at location 189 on the protein
  • Active Site Description: By similarity.
DPDVKIKLK3.1.1;Carboxylic ester hydrolases. 205
  • Gene: AAAD
RFWSEYFTTDR3.1.1;Carboxylic ester hydrolases. 248
  • Gene: AAAD

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKS
EA
LRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQ
QLLD
DPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNP
NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL



DME EC Prediction for this protein is: 3.1.1.79
Check another protein