Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FLGIPFA3.1.1;Carboxylic ester hydrolases. 63 -
GPRRFLPPEPK3.1.1.7;Acetylcholinesterase. 74
  • Gene: ACES
CYQYVDT3.1.1.7;Acetylcholinesterase. 100
  • Gene: ACES
LSEDCLYLNVW3.1.1;Carboxylic ester hydrolases. 123 -
WIYGGGF3.1.1;Carboxylic ester hydrolases. 148 -
GGGFYSG3.1.1.7;Acetylcholinesterase. 151 -
SLDVYDGR3.1.1;Carboxylic ester hydrolases. 160 -
VSMNYRVG3.1.1;Carboxylic ester hydrolases. 178 -
AFGFLAL3.1.1.7;Acetylcholinesterase. 186
  • Gene: ACES
GFLALPG3.1.1;Carboxylic ester hydrolases. 188 -
LALQWVQ3.1.1;Carboxylic ester hydrolases. 209 -
FGESAGA3.1.1;Carboxylic ester hydrolases. 231
  • Active Site S=Serine at location 234 on the protein
  • Active Site Description: Acyl-ester intermediate (By si
PNGPWAT3.1.1.7;Acetylcholinesterase. 263
  • Gene: ACES
GEARRRAT3.1.1.7;Acetylcholinesterase. 273
  • Gene: ACES
LVGCPPGG3.1.1.7;Acetylcholinesterase. 285
  • Gene: ACES
FRFSFVPV3.1.1.7;Acetylcholinesterase. 326
  • Gene: ACES
YGAPGFSKD3.1.1;Carboxylic ester hydrolases. 372 -
FLAGVRVGVPQ3.1.1.7;Acetylcholinesterase. 390
  • Gene: ACES
LAAEAVVLHYTDWL3.1.1.7;Acetylcholinesterase. 404
  • Gene: ACES
VGDHNVVCP3.1.1.7;Acetylcholinesterase. 433
  • Gene: ACES
HGYEIEF3.1.1;Carboxylic ester hydrolases. 478
  • Active Site H=Histidine at location 478 on the protein
  • Active Site Description: Charge relay system (By simila
YWANFARTG3.1.1;Carboxylic ester hydrolases. 510 -
FARTGDPN3.1.1;Carboxylic ester hydrolases. 514 -
PQWPPYT3.1.1.7;Acetylcholinesterase. 529
  • Gene: ACES
PLEVRRGLRAQ3.1.1.7;Acetylcholinesterase. 548
  • Gene: ACES
EFHRWSSYM3.1.1.7;Acetylcholinesterase. 587
  • Gene: ACES
QFDHYSKQ3.1.1.7;Acetylcholinesterase. 601
  • Gene: ACES

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVC
YQYVDT
LYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPG
NVGLLDQR
LALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESV
FRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQ
VSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEE
KIFAQRLMR
YWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL



DME EC Prediction for this protein is: 3.1.1.7
Check another protein