Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LELGAYCGYSAVRMARLL2.1.1.6;Catechol O-methyltransferase. 113
  • Binding Site S=Serine at location 122 on the protein
  • Binding site description: S-adenosyl-L-methionine (By si
  • Gene: COMT
LLLEECGLLR2.1.1.6;Catechol O-methyltransferase. 202
  • Gene: COMT
GTVLLADNVI2.1.1.6;Catechol O-methyltransferase. 213
  • Metal Site D=Aspartic acid at location 219 on the protein
  • Metal Site Description: Magnesium (By similarity).
  • Binding Site N=Asparagine at location 220 on the protein
  • Binding site description: Substrate (By similarity).
  • Gene: COMT

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIV
DAVIQEHQPSVL
LELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPD
T
LLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP



DME EC Prediction for this protein is: 2.1.1.6
Check another protein