Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LTLFRYSDWQDKLFM3.6.3.44;Xenobiotic-transporting ATPase. 43 -
MTRYAYYYSG3.6.3.44;Xenobiotic-transporting ATPase. 113
  • Domain: ABC transmembrane ty
AYIQVSFW3.6.3.44;Xenobiotic-transporting ATPase. 131
  • Domain: ABC transmembrane ty
KIRQKFFHAI3.6.3.44;Xenobiotic-transporting ATPase. 148
  • Domain: ABC transmembrane ty
QEIGWFD3.6.3.44;Xenobiotic-transporting ATPase. 160
  • Domain: ABC transmembrane ty
ELNTRLTDD3.6.3.44;Xenobiotic-transporting ATPase. 172
  • Domain: ABC transmembrane ty
GWKLTLV3.6.3.44;Xenobiotic-transporting ATPase. 213
  • Domain: ABC transmembrane ty
AYAKAGAVAEE3.6.3.44;Xenobiotic-transporting ATPase. 248
  • Domain: ABC transmembrane ty
AIRTVIAFGGQ3.6.3.44;Xenobiotic-transporting ATPase. 262
  • Domain: ABC transmembrane ty
AFLLIYASYALAFWYG3.6.3.44;Xenobiotic-transporting ATPase. 304
  • Domain: ABC transmembrane ty
LIGAFSVGQA3.6.3.44;Xenobiotic-transporting ATPase. 341
  • Domain: ABC transmembrane ty
DVHFSYPSRAN3.6.3.44;Xenobiotic-transporting ATPase. 398
  • Domain: ABC transporter
ILKGLNLKV3.6.3.44;Xenobiotic-transporting ATPase. 411
  • Domain: ABC transporter
GQTVALVG3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 422
  • Domain: ABC transporter
SGCGKSTTVQL3.6.3.44;Xenobiotic-transporting ATPase. 431
  • Domain: ABC transporter
VSQEPVLF3.6.3.44;Xenobiotic-transporting ATPase. 475
  • Domain: ABC transporter
KAVKEANAY3.6.3.44;Xenobiotic-transporting ATPase. 504
  • Domain: ABC transporter
QLSGGQKQR3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 532
  • Domain: ABC transporter
QLSGGQKQRIAIARALVR3.6.3.44;Xenobiotic-transporting ATPase. 532
  • Domain: ABC transporter
QRIAIARA3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 539
  • Domain: ABC transporter
LVRNPKIL3.6.3.44;Xenobiotic-transporting ATPase. 547
  • Domain: ABC transporter
KILLLDE3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 552
  • Domain: ABC transporter
LLLDEATSALD3.6.3.44;Xenobiotic-transporting ATPase. 554
  • Domain: ABC transporter
LDEATSALDTESE3.6.3.44;Xenobiotic-transporting ATPase. 556
  • Domain: ABC transporter
ALDKAREGRT3.6.3.44;Xenobiotic-transporting ATPase. 574
  • Domain: ABC transporter
VIAHRLST3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 586
  • Domain: ABC transporter
IAHRLSTVR3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 587
  • Domain: ABC transporter
RNADVIAGF3.6.3.44;Xenobiotic-transporting ATPase. 595
  • Domain: ABC transporter
GVIVEQG3.6.3.44;Xenobiotic-transporting ATPase. 606
  • Domain: ABC transporter
EWPYFVVG3.6.3.44;Xenobiotic-transporting ATPase. 707 -
TFFLQGFTFGKAGEILT3.6.3.44;Xenobiotic-transporting ATPase. 768
  • Domain: ABC transmembrane ty
KNSTGALSTRLATD3.6.3.44;Xenobiotic-transporting ATPase. 807
  • Domain: ABC transmembrane ty
ANLGTGII3.6.3.44;Xenobiotic-transporting ATPase. 840
  • Domain: ABC transmembrane ty
YGWQLTLLL3.6.3.44;Xenobiotic-transporting ATPase. 852
  • Domain: ABC transmembrane ty
GKIATEAIEN3.6.3.44;Xenobiotic-transporting ATPase. 893
  • Domain: ABC transmembrane ty
RTVVSLT3.6.3.44;Xenobiotic-transporting ATPase. 904
  • Domain: ABC transmembrane ty
SSFAPDYAKA3.6.3.44;Xenobiotic-transporting ATPase. 991
  • Domain: ABC transmembrane ty
LFERQPLIDSYS3.6.3.44;Xenobiotic-transporting ATPase. 1010 -
FNEVVFNYPTR3.6.3.44;Xenobiotic-transporting ATPase. 1036
  • Domain: ABC transporter
EVKKGQTL3.6.3.44;Xenobiotic-transporting ATPase. 1058
  • Domain: ABC transporter
KGQTLAL3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1061
  • Domain: ABC transporter
LVGSSGCGKSTVVQLLERFY3.6.3.44;Xenobiotic-transporting ATPase. 1067
  • Domain: ABC transporter
LNVQWLRA3.6.3.44;Xenobiotic-transporting ATPase. 1110
  • Domain: ABC transporter
LGIVSQEP3.6.3.44;Xenobiotic-transporting ATPase. 1119
  • Domain: ABC transporter
LFDCSIAENI3.6.3.44;Xenobiotic-transporting ATPase. 1128
  • Domain: ABC transporter
QLSGGQKQR3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1181
  • Domain: ABC transporter
QRIAIARA3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1188
  • Domain: ABC transporter
LLLDEATSALD3.6.3.44;Xenobiotic-transporting ATPase. 1203
  • Domain: ABC transporter
LDEATSALDTESE3.6.3.44;Xenobiotic-transporting ATPase. 1205
  • Domain: ABC transporter
VQEALDKAR3.6.3.44;Xenobiotic-transporting ATPase. 1220
  • Domain: ABC transporter
ALDKAREGRT3.6.3.44;Xenobiotic-transporting ATPase. 1223
  • Domain: ABC transporter
VIAHRLST3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1235
  • Domain: ABC transporter
VIAHRLSTIQNAD3.6.3.44;Xenobiotic-transporting ATPase. 1235
  • Domain: ABC transporter
AHRLSTI3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1237
  • Domain: ABC transporter
GTHQQLL3.6.3.44;Xenobiotic-transporting ATPase. 1261
  • Domain: ABC transporter

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDLEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQDKLFMSLGTIMAIAHGSGLPLMMIVFGEMTDKFVDTAGNFSFPVNFSL
SLLNPGKILEEE
MTRYAYYYSGLGAGVLVAAYIQVSFWTLAAGRQIRKIRQKFFHAILRQEIGWFDINDTTELNTRLTDDISKISEGIGDKVGMFFQAVA
TFFAGFIVGFIR
GWKLTLVIMAISPILGLSAAVWAKILSAFSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANIS
MGI
AFLLIYASYALAFWYGSTLVISKEYTIGNAMTVFFSILIGAFSVGQAAPCIDAFANARGAAYVIFDIIDNNPKIDSFSERGHKPDSIKGNLEFNDVH
FSYPSRAN
VKILKGLNLKVQSGQTVALVGSSGCGKSTTVQLIQRLYDPDEGTINIDGQDIRNFNVNYLREIIGVVSQEPVLFSTTIAENICYGRGNVTMD
EIK
KAVKEANAYEFIMKLPQKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTVRNADVI
AGF
EDGVIVEQGSHSELMKKEGVYFKLVNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVSFLKV
LKLNKT
EWPYFVVGTVCAIANGGLQPAFSVIFSEIIAIFGPGDDAVKQQKCNIFSLIFLFLGIISFFTFFLQGFTFGKAGEILTRRLRSMAFKAMLRQDM
SWFDDH
KNSTGALSTRLATDAAQVQGATGTRLALIAQNIANLGTGIIISFIYGWQLTLLLLAVVPIIAVSGIVEMKLLAGNAKRDKKELEAAGKIATEAI
EN
IRTVVSLTQERKFESMYVEKLYGPYRNSVQKAHIYGITFSISQAFMYFSYAGCFRFGAYLIVNGHMRFRDVILVFSAIVFGAVALGHASSFAPDYAKA
KLSAAHLFMLFERQPLIDSYSEEGLKPDKFEGNITFNEVVFNYPTRANVPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGTVFVDFGFQ
LLDGQEAKK
LNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSQDEIVSAAKAANIHPFIETLPHKYETRVGDKGTQLSGGQKQRIAIARALIRQP
QI
LLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQAGTQNL



DME EC Prediction for this protein is: 3.6.3.44
Check another protein