Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SIRVLLE4.2.1.3;Aconitate hydratase. 38 -
QDFTGVP4.2.1.3;Aconitate hydratase. 86 -
KINPVCP4.2.1.3;Aconitate hydratase. 113
  • Gene: ACOC
DLVIDHS4.2.1.3;Aconitate hydratase. 121 -
HQVNLEYLA4.2.1.3;Aconitate hydratase. 178 -
GTDSHTTM4.2.1.3;Aconitate hydratase. 203 -
GWGVGGIEAEA4.2.1.3;Aconitate hydratase. 218 -
VVGKFVEF4.2.1.3;Aconitate hydratase. 273 -
LSIADRATIANMCPEYGAT4.2.1.3;Aconitate hydratase. 288
  • Gene: ACOC
SQDPDFTQVVELDL4.2.1.3;Aconitate hydratase. 350
  • Gene: ACOC
GPKRPQD4.2.1.3;Aconitate hydratase. 372 -
CLGAKQGFKGFQ4.2.1.3;Aconitate hydratase. 392
  • Gene: ACOC
HHNDHKTFIY4.2.1.3;Aconitate hydratase. 408
  • Gene: ACOC
IAAITSCTNTS4.2.1.3;Aconitate hydratase. 431
  • Metal Site C=Cysteine at location 437 on the protein
  • Metal Site Description: Iron-sulfur (4Fe-4S) (By simil
TSCTNTSNP4.2.1.3;Aconitate hydratase. 435
  • Metal Site C=Cysteine at location 437 on the protein
  • Metal Site Description: Iron-sulfur (4Fe-4S) (By simil
KTSLSPGSGVVT4.2.1.3;Aconitate hydratase. 468
  • Gene: ACOC
GYGCMTCIGNSG4.2.1.3;Aconitate hydratase. 500
  • Metal Site C=Cysteine at location 503 on the protein
  • Metal Site Description: Iron-sulfur (4Fe-4S) (By simil
SGNRNFEGR4.2.1.3;Aconitate hydratase. 533 -
NRNFEGR4.2.1;Hydro-lyases. 535 -
ANYLASP4.2.1.3;Aconitate hydratase. 548 -
VIAYAIAGT4.2.1.3;Aconitate hydratase. 557 -
IDFEKEP4.2.1.3;Aconitate hydratase. 568 -
EIQAVERQYVIPGMF4.2.1.3;Aconitate hydratase. 595
  • Gene: ACOC
EVYQKIETVN4.2.1.3;Aconitate hydratase. 611
  • Gene: ACOC
DAYVLLN4.2.1.3;Aconitate hydratase. 664
  • Gene: ACOC
LGDSVTTDHISPA4.2.1.3;Aconitate hydratase. 671 -
TTDHISPAG4.2.1.3;Aconitate hydratase. 676 -
YGSRRGN4.2.1.3;Aconitate hydratase. 709 -
RGTFANIR4.2.1.3;Aconitate hydratase. 721 -
PLIVLAGKEYG4.2.1.3;Aconitate hydratase. 765
  • Gene: ACOC
GSSRDWAAKG4.2.1.3;Aconitate hydratase. 777 -
ERIHRSNLVGMGV4.2.1.3;Aconitate hydratase. 801 -
SNLVGMGVIPLEYLPGE4.2.1.3;Aconitate hydratase. 806
  • Gene: ACOC
RFDTDVELTY4.2.1.3;Aconitate hydratase. 864
  • Gene: ACOC

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAM
RDAVKKLGGDPE
KINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDS
LV
GTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMC
PEYGAT
AAFFPVDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFK
GFQ
VAPEHHNDHKTFIYDNTEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPYLSQLGFDVVG
YGCMTCIGNSG
PLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVE
RQYVIPGMF
KEVYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRG
LTPREFNS
YGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAGSSRDWAAKGPFLLGIKAVLAESY
ERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK



DME EC Prediction for this protein is: 4.2.1.3
Check another protein