Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
YSLIIKDV2.7.10.1;Receptor protein-tyrosine kinase. 388
  • Domain: Ig-like C2-type
  • Gene: VGFR1
VNVKPQIYE2.7.10.1;Receptor protein-tyrosine kinase. 424
  • Gene: VGFR1
YLSIIMDP2.7.10.1;Receptor protein-tyrosine kinase. 794 -
ARERLKLGKSLG2.7.10.1;Receptor protein-tyrosine kinase. 823
  • Gene: VGFR1
GAFGKVVQASAFGIKKSPTCR2.7.10.1;Receptor protein-tyrosine kinase. 836
  • Domain: Protein kinase
  • Gene: VGFR1
VAVKMLK2.7.10.1;Receptor protein-tyrosine kinase. 858
  • Binding Site K=Lysine at location 861 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
KMLKEGAT2.7.10.1;Receptor protein-tyrosine kinase. 861
  • Binding Site K=Lysine at location 861 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
HLNVVNLLGACTK2.7.10.1;Receptor protein-tyrosine kinase. 888
  • Domain: Protein kinase
GPLMVIVE2.7.10.1;Receptor protein-tyrosine kinase. 903
  • Domain: Protein kinase
CKYGNLSN2.7.10.1;Receptor protein-tyrosine kinase. 912
  • Domain: Protein kinase
SLSDVEEE2.7.10.1;Receptor protein-tyrosine kinase. 976
  • Domain: Protein kinase
QVARGME2.7.10.1;Receptor protein-tyrosine kinase. 1005
  • Domain: Protein kinase
SRKCIHRDLAARNILLSE2.7.10.1;Receptor protein-tyrosine kinase. 1015
  • Active Site D=Aspartic acid at location 1022 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 1021
  • Active Site D=Aspartic acid at location 1022 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KICDFGLARD2.7.10.1;Receptor protein-tyrosine kinase. 1037
  • Domain: Protein kinase
DFGLARDI2.7.10.1;Receptor protein-tyrosine kinase. 1040
  • Domain: Protein kinase
PDYVRKG2.7.10.1;Receptor protein-tyrosine kinase. 1051
  • Domain: Protein kinase
RLPLKWMAPE2.7.10.1;Receptor protein-tyrosine kinase. 1060
  • Domain: Protein kinase
KWMAPESIF2.7.10.1;Receptor protein-tyrosine kinase. 1064
  • Domain: Protein kinase
WEIFSLG2.7.10.1;Receptor protein-tyrosine kinase. 1090
  • Domain: Protein kinase
YQIMLDCW2.7.10;Protein-tyrosine kinases. 1130
  • Domain: Protein kinase
RIKTFEE2.7.10.1;Receptor protein-tyrosine kinase. 1224 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN
HTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYK
EIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRG
YSLIIKDVTEEDA
GNYTILLSIKQSNVFKNLTATLI
VNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGN
RIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHK
IQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFIRKMKRSSSEIKTD
YLSIIMD
P
DEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGKVVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSVTSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLI
SYSF
QVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPY
PGVQMDEDFCSRLREGMRMRAPEYSTPEI
YQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISA
PKFNSGSSDDVRYVNAFKFMSLE
RIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTWTDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHV
SEGKRRFTYDHAELERKIACCSPPPDYNSVVLYSTPPI



DME EC Prediction for this protein is: 2.7.10.1
Check another protein