Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
AAHFFEGTEKLLE4.1.1.50;Adenosylmethionine decarboxylase. 3
  • Active Site E=Glutamic acid at location 8 on the protein
  • Active Site Description: By similarity.
  • Binding Site F=Phenylalanine at location 7 on the protein
  • Binding site description: Substrate.
QGSGDLRTIPRSEWD4.1.1.50;Adenosylmethionine decarboxylase. 27 -
YVLSESS4.1.1.50;Adenosylmethionine decarboxylase. 63
  • Active Site S=Serine at location 68 on the protein
  • Active Site Description: Schiff-base intermediate with
  • Binding Site E=Glutamic acid at location 67 on the protein
  • Binding site description: Substrate.
FVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQ4.1.1.50;Adenosylmethionine decarboxylase. 71
  • Active Site C=Cysteine at location 82 on the protein
  • Active Site Description: Proton donor; for catalytic ac
FFYSRKNFMKP4.1.1.50;Adenosylmethionine decarboxylase. 110 -
IFPNGAAYCMGR4.1.1.50;Adenosylmethionine decarboxylase. 140 -
NSDCWYLYTLD4.1.1.50;Adenosylmethionine decarboxylase. 153 -
VMDQFYMK4.1.1.50;Adenosylmethionine decarboxylase. 188 -
PCGYSMN4.1.1.50;Adenosylmethionine decarboxylase. 225
  • Active Site S=Serine at location 229 on the protein
  • Active Site Description: Proton acceptor; for processin
TIHITPE4.1.1.50;Adenosylmethionine decarboxylase. 241
  • Active Site H=Histidine at location 243 on the protein
  • Active Site Description: Proton acceptor; for processin
FSYVSFETN4.1.1.50;Adenosylmethionine decarboxylase. 250 -
KFVTTLFVNQSSKCRT4.1.1.50;Adenosylmethionine decarboxylase. 279 -
GFKRLDCQSA4.1.1.50;Adenosylmethionine decarboxylase. 304 -
FNDYNFVFTSFAK4.1.1.50;Adenosylmethionine decarboxylase. 315 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEAAHFFEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSESSMFVSKRRFILKTCGTTLLLKALVPLLKLARD
YSGFDSIQ
SFFYSRKNFMKPSHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTA
KDVTRESGIRDLIPGSVIDATMFN
PCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQ
KIE
GFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS



DME EC Prediction for this protein is: 4.1.1.50
Check another protein