Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QFENISIYN1.14.18;With another compound as one donor 178
  • Gene: TYRP1
FVWTHYYS1.14.18;With another compound as one donor 188
  • Metal Site H=Histidine at location 192 on the protein
  • Metal Site Description: Copper A (By similarity).
  • Gene: TYRP1
NSVFSQWRV1.14.18;With another compound as one donor 280
  • Gene: TYRP1
SFRNTVEGYS1.14.18;With another compound as one donor 354
  • Gene: TYRP1
VRSLHNLAHLFLNGTGGQTH1.14.18;With another compound as one donor 373
  • Metal Site H=Histidine at location 377 on the protein
  • Metal Site Description: Copper B (By similarity).
  • Gene: TYRP1
SPNDPIFVLLHTFTDAVFDEWLRR1.14.18;With another compound as one donor 394
  • Metal Site H=Histidine at location 404 on the protein
  • Metal Site Description: Copper B (By similarity).
  • Gene: TYRP1
NDPIFVL1.14.18.1;Monophenol monooxygenase. 396 -
NAPIGHN1.14.18.1;Monophenol monooxygenase. 429 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCH
CNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTP
QFENISIYNYFVWTHYYSVKKTF
LGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISP
NSVFSQWRVVCDSLEDYDTLG
TLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTN
SFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIF
VLLHTFTDAVFDEWLRR
YNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIAIAVVGALLLVALIFGTASYL
IRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV



DME EC Prediction for this protein is: 1.14.18.1
Check another protein