Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RKGALRQK2.7.11.13;Protein kinase C. 22 -
GALRQKNVHE2.7.11.13;Protein kinase C. 24 -
RFFKQPTFCSHC2.7.11.13;Protein kinase C. 42 -
WGFGKQG2.7.11.13;Protein kinase C. 58 -
VVHKRCH2.7.11.13;Protein kinase C. 73 -
RCHEFVTF2.7.11.13;Protein kinase C. 77 -
CPGADKG2.7.11.13;Protein kinase C. 86 -
DDPRSKHKFKIHTY2.7.11.13;Protein kinase C. 96 -
TFCDHCGSLL2.7.11.13;Protein kinase C. 113 -
VRDAKNL2.7.11.13;Protein kinase C. 177
  • Domain: C2
PMDPNGL2.7.11.13;Protein kinase C. 185
  • Metal Site M=Methionine at location 186 on the protein
  • Metal Site Description: Calcium 1; via carbonyl oxygen
  • Domain: C2
VKLKLIPD2.7.11.13;Protein kinase C. 196
  • Domain: C2
ESKQKTKTI2.7.11.13;Protein kinase C. 207
  • Domain: C2
ESFTFKLKPSDKDRRLS2.7.11.13;Protein kinase C. 225
  • Domain: C2
  • Gene: KPCA
RNDFMGSLSFG2.7.11.13;Protein kinase C. 252
  • Metal Site R=Arginine at location 252 on the protein
  • Metal Site Description: Calcium 3; via carbonyl oxygen
  • Domain: C2
KLLNQEEGE2.7.11.13;Protein kinase C. 276 -
EGEYYNVP2.7.11.13;Protein kinase C. 282 -
ELRQKFEKAKLGP2.7.11.13;Protein kinase C. 300
  • Gene: KPCA
VLGKGSFGKV2.7.11.13;Protein kinase C. 344
  • Domain: Protein kinase
GKGSFGKV2.7.11;Protein-serine/threonine kinases. 346
  • Domain: Protein kinase
GTEELYA2.7.11;Protein-serine/threonine kinases. 360
  • Domain: Protein kinase
QDDDVECTM2.7.11.13;Protein kinase C. 377
  • Domain: Protein kinase
DDDVECTMVEKRVL2.7.11.13;Protein kinase C. 378
  • Domain: Protein kinase
EKRVLAL2.7.11.13;Protein kinase C. 387
  • Domain: Protein kinase
LHSCFQT2.7.11.13;Protein kinase C. 403
  • Domain: Protein kinase
DRLYFVME2.7.11.13;Protein kinase C. 411
  • Domain: Protein kinase
FVMEYVNGG2.7.11;Protein-serine/threonine kinases. 415
  • Domain: Protein kinase
VNGGDLM2.7.11.13;Protein kinase C. 420
  • Domain: Protein kinase
GIIYRDLK2.7.11;Protein-serine/threonine kinases. 458
  • Active Site D=Aspartic acid at location 463 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
YRDLKLDN2.7.11.13;Protein kinase C. 461
  • Active Site D=Aspartic acid at location 463 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLKLDN2.7.11;Protein-serine/threonine kinases. 462
  • Active Site D=Aspartic acid at location 463 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
GHIKIAD2.7.11;Protein-serine/threonine kinases. 475
  • Domain: Protein kinase
DFGMCKE2.7.11.13;Protein kinase C. 481
  • Domain: Protein kinase
TTRTFCGT2.7.11;Protein-serine/threonine kinases. 494
  • Domain: Protein kinase
TFCGTPDYIAPEI2.7.11.13;Protein kinase C. 497
  • Domain: Protein kinase
GTPDYIAPE2.7.11;Protein-serine/threonine kinases. 500
  • Domain: Protein kinase
PYGKSVD2.7.11;Protein-serine/threonine kinases. 514
  • Domain: Protein kinase
GVLLYEM2.7.11;Protein-serine/threonine kinases. 525
  • Domain: Protein kinase
GVLLYEMLAGQ2.7.11.13;Protein kinase C. 525
  • Domain: Protein kinase
GQPPFDGEDE2.7.11.13;Protein kinase C. 534
  • Domain: Protein kinase
GEDEDELFQSIMEH2.7.11.13;Protein kinase C. 540
  • Domain: Protein kinase
HNVSYPK2.7.11.13;Protein kinase C. 553
  • Domain: Protein kinase
LSKEAVS2.7.11.13;Protein kinase C. 561
  • Domain: Protein kinase
KRLGCGP2.7.11;Protein-serine/threonine kinases. 579
  • Domain: Protein kinase
KRLGCGPEGERD2.7.11.13;Protein kinase C. 579
  • Domain: Protein kinase
FFRRIDW2.7.11.13;Protein kinase C. 596
  • Domain: Protein kinase
NREIQPPF2.7.11.13;Protein kinase C. 607
  • Domain: AGC-kinase C-termina
ENFDKFFTR2.7.11.13;Protein kinase C. 624
  • Domain: AGC-kinase C-termina
GFSYVNP2.7.11.13;Protein kinase C. 655
  • Domain: AGC-kinase C-termina

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRS
KHKFKIHTY
GSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKL
IPD
PKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGP
AGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFL
TQ
LHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCG
TPDYIAPEI
IAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DW
EKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV



DME EC Prediction for this protein is: 2.7.11.13
Check another protein