Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PALHHPVFQQ2.1.1.63;Methylated-DNA--[protein]-cysteine S-methyltransferase. 82
  • Metal Site H=Histidine at location 85 on the protein
  • Metal Site Description: Zinc (By similarity).
  • Gene: MGMT
SFTRQVLWKLLKVVKFGE2.1.1.63;Methylated-DNA--[protein]-cysteine S-methyltransferase. 93
  • Binding Site T=Threonine at location 95 on the protein
  • Binding site description: DNA; via amide nitrogen (By si
  • Gene: MGMT
SYQQLAALAGNPKAARAVGGAMR2.1.1.63;Methylated-DNA--[protein]-cysteine S-methyltransferase. 113
  • Binding Site Y=Tyrosine at location 114 on the protein
  • Binding site description: DNA (By similarity).
  • Gene: MGMT
NPVPILIPCHRV2.1.1.63;Methylated-DNA--[protein]-cysteine S-methyltransferase. 137
  • Active Site C=Cysteine at location 145 on the protein
  • Active Site Description: Nucleophile; methyl group acce
  • Gene: MGMT
KEWLLAHEG2.1.1.63;Methylated-DNA--[protein]-cysteine S-methyltransferase. 165
  • Gene: MGMT

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLW
KLLKVVKFGE
VISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSG
SPPAGRN



DME EC Prediction for this protein is: 2.1.1.63
Check another protein