Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QSVELPET1.3.99.2;Butyryl-CoA dehydrogenase. 30
  • Gene: ACADS
GAGLDYLAY1.3.99.2;Butyryl-CoA dehydrogenase. 90
  • Gene: ACADS
IAMEEISR1.3.99;With other acceptors. 100 -
GCFALSEPGNGSDAGAA1.3.99.2;Butyryl-CoA dehydrogenase. 150
  • Binding Site S=Serine at location 161 on the protein
  • Binding site description: Substrate; via carbonyl oxygen
  • Gene: ACADS
SSTANLIFEDCRIPK1.3.99.2;Butyryl-CoA dehydrogenase. 236
  • Gene: ACADS
AFGAPLTKLQ1.3.99.2;Butyryl-CoA dehydrogenase. 299
  • Gene: ACADS
IQFKLADMALALESARLLTWRAAMLKDNKK1.3.99.2;Butyryl-CoA dehydrogenase. 310
  • Gene: ACADS
QILGGMGYV1.3.99.2;Butyryl-CoA dehydrogenase. 365
  • Gene: ACADS
MGYVTEMPAER1.3.99.2;Butyryl-CoA dehydrogenase. 370
  • Gene: ACADS
ITEIYEGTSE1.3.99.2;Butyryl-CoA dehydrogenase. 387
  • Active Site E=Glutamic acid at location 392 on the protein
  • Active Site Description: Proton acceptor (By similarity
EIQRLVI1.3.99.2;Butyryl-CoA dehydrogenase. 396 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAALLARASGPARRALCPRAWRQLHTIYQSVELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAI
AMEEISR
GCASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEASAAVVFAS
TDRALQNKGISAFLVPMPTPGLTLGKKEDKLGIRG
SSTANLIFEDCRIPKDSILGEPGMGFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENRMAF
GAPLTKLQ
VIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRL
VI
AGHLLRSYRS



DME EC Prediction for this protein is: 1.3.99.2
Check another protein