Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LWLVGQHGE1.13.11;With incorporation of two atoms of oxygen. 24
  • Domain: PLAT
LLFVKLRKRHLL1.13.11;With incorporation of two atoms of oxygen. 60
  • Domain: PLAT
DAWFCNWISV1.13.11;With incorporation of two atoms of oxygen. 74
  • Domain: PLAT
LYRWGNWKDG1.13.11;With incorporation of two atoms of oxygen. 138
  • Domain: Lipoxygenase
DLPVDERFLEDK1.13.11;With incorporation of two atoms of oxygen. 159
  • Domain: Lipoxygenase
LDDFNRIFWCG1.13.11;With incorporation of two atoms of oxygen. 200
  • Domain: Lipoxygenase
FNRIFWCGQSKLAE1.13.11;With incorporation of two atoms of oxygen. 203
  • Domain: Lipoxygenase
FGYQFLNG1.13.11;With incorporation of two atoms of oxygen. 228
  • Domain: Lipoxygenase
GMEELQAQLEKEL1.13.11;With incorporation of two atoms of oxygen. 256
  • Domain: Lipoxygenase
GTLFEADF1.13.11;With incorporation of two atoms of oxygen. 271
  • Domain: Lipoxygenase
GIKANVILC1.13.11;With incorporation of two atoms of oxygen. 283
  • Domain: Lipoxygenase
WVRSSDF1.13.11;With incorporation of two atoms of oxygen. 346
  • Domain: Lipoxygenase
RYTLEIN1.13.11;With incorporation of two atoms of oxygen. 394
  • Domain: Lipoxygenase
CPPDDLA1.13.11;With incorporation of two atoms of oxygen. 442
  • Domain: Lipoxygenase
MCIFTCTGQH1.13.11;With incorporation of two atoms of oxygen. 531
  • Domain: Lipoxygenase
HLGQLDW1.13.11;With incorporation of two atoms of oxygen. 544
  • Metal Site H=Histidine at location 544 on the protein
  • Metal Site Description: Iron; catalytic.
  • Domain: Lipoxygenase
WVPNAPCTMR1.13.11;With incorporation of two atoms of oxygen. 553
  • Domain: Lipoxygenase
EEYFSGP1.13.11;With incorporation of two atoms of oxygen. 611
  • Domain: Lipoxygenase
KFREELA1.13.11;With incorporation of two atoms of oxygen. 625
  • Domain: Lipoxygenase
PYEYLRPS1.13.11;With incorporation of two atoms of oxygen. 647
  • Domain: Lipoxygenase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWV
EGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRK
LYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDL
DDFNRIFWCGQSKLAE
RVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL
VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKC
WVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEIN
VRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCR
EITEIGLQGAQDRGFPVSLQARDQVCHFVT
MCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ
PVMVAVGQHE
EEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI



DME EC Prediction for this protein is: 1.13.11
Check another protein