Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LGILGILLGVAA3.4.11.2;Membrane alanyl aminopeptidase. 11
  • Gene: AMPN
WNRYRLP3.4.11.2;Membrane alanyl aminopeptidase. 71
  • Gene: AMPN
STVRFTC3.4.11.2;Membrane alanyl aminopeptidase. 107
  • Gene: AMPN
VIIIHSKKLNYT3.4.11.2;Membrane alanyl aminopeptidase. 119
  • Gene: AMPN
TEYLVVHL3.4.11.2;Membrane alanyl aminopeptidase. 159
  • Gene: AMPN
ARKSFPCFDEP3.4.11;Aminopeptidases. 217 -
VTGPILNFFA3.4.11.2;Membrane alanyl aminopeptidase. 320
  • Gene: AMPN
LPDFNAGAMENWGLVTYRE3.4.11.2;Membrane alanyl aminopeptidase. 346
  • Gene: AMPN
GAMENWG3.4.11;Aminopeptidases. 352 -
HELAHQWFG3.4.11;Aminopeptidases. 388
  • Active Site E=Glutamic acid at location 389 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 388 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
WFGNLVT3.4.11;Aminopeptidases. 394 -
WWNDLWLNE3.4.11;Aminopeptidases. 403 -
WWNDLWLNEGFASYVE3.4.11.2;Membrane alanyl aminopeptidase. 403
  • Metal Site E=Glutamic acid at location 411 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Gene: AMPN
WLNEGFA3.4.11;Aminopeptidases. 408
  • Metal Site E=Glutamic acid at location 411 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
AEPTWNLKDL3.4.11.2;Membrane alanyl aminopeptidase. 425
  • Gene: AMPN
DVYRVMAVDALASSHPL3.4.11.2;Membrane alanyl aminopeptidase. 439
  • Gene: AMPN
NTPAQISE3.4.11.2;Membrane alanyl aminopeptidase. 463
  • Gene: AMPN
IPVINRAQ3.4.11.2;Membrane alanyl aminopeptidase. 653
  • Gene: AMPN
LMFDRSEVYGPMK3.4.11.2;Membrane alanyl aminopeptidase. 707
  • Gene: AMPN
NNPIHPNLR3.4.11.2;Membrane alanyl aminopeptidase. 785
  • Gene: AMPN
LVNEADKLR3.4.11.2;Membrane alanyl aminopeptidase. 821
  • Gene: AMPN
LNRYLSYTLNPD3.4.11.2;Membrane alanyl aminopeptidase. 841
  • Gene: AMPN
SNWKKLF3.4.11.2;Membrane alanyl aminopeptidase. 882
  • Gene: AMPN
ELQQLEQF3.4.11.2;Membrane alanyl aminopeptidase. 914
  • Gene: AMPN

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGL
YVFKGS
STVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYME
GNVRKVVATTQMQAAD
ARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
RIWARPSAIAAGHGDYALN
VTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVT
IEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKGASVLRMLSSFLSEDVFKQGL
ASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSA
IPVINRAQIINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALS
SLSYFK
LMFDRSEVYGPMKNYLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWMENPNNNPIHPNLRSTVYCNA
IAQGGEEEWDFAWEQFRNAT
LVNEADKLRAALACSKELWILNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN
LIQAVTRRFSTEY
ELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK



DME EC Prediction for this protein is: 3.4.11.2
Check another protein