Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GLGTWKS1.1.1;With NAD(+) or NADP(+) as acceptor. 17 -
EAVKVAID1.1.1;With NAD(+) or NADP(+) as acceptor. 30 -
GYRHIDCA1.1.1;With NAD(+) or NADP(+) as acceptor. 39
  • Binding Site D=Aspartic acid at location 44 on the protein
  • Binding site description: NADP.
LFIVSKLW1.1.1;With NAD(+) or NADP(+) as acceptor. 73 -
DLKLDYLD1.1.1.21;Aldehyde reductase. 99 -
LDYLDLYLIHWP1.1.1;With NAD(+) or NADP(+) as acceptor. 102
  • Binding Site H=Histidine at location 111 on the protein
  • Binding site description: Substrate (By similarity).
NQIECHPYL1.1.1;With NAD(+) or NADP(+) as acceptor. 183 -
HPYLTQEKLI1.1.1.21;Aldehyde reductase. 188 -
VTAYSPLGS1.1.1;With NAD(+) or NADP(+) as acceptor. 207 -
VTAYSPLGSPDRP1.1.1.21;Aldehyde reductase. 207 -
AKPEDPSLLEDP1.1.1.21;Aldehyde reductase. 221 -
IPKSVTP1.1.1;With NAD(+) or NADP(+) as acceptor. 261 -
TLLSYNRNWRVCAL1.1.1.21;Aldehyde reductase. 288
  • Gene: ALDR

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDL
KLDYLDLYLIHWP
TGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYC
QSKGIV
VTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
L
LSCTSHKDYPFHEEF



DME EC Prediction for this protein is: 1.1.1.21
Check another protein