Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PRCGVPD3.4.24;Metalloendopeptidases. 97
  • Metal Site C=Cysteine at location 99 on the protein
  • Metal Site Description: Zinc; in inhibited form (By si
DGYPFDG3.4.24;Metalloendopeptidases. 177
  • Metal Site D=Aspartic acid at location 177 on the protein
  • Metal Site Description: Zinc 1; structural (By similar
GLLAHAF3.4.24;Metalloendopeptidases. 186
  • Metal Site L=Leucine at location 187 on the protein
  • Metal Site Description: Calcium 3; via carbonyl oxygen
GLLAHAFPPG3.4.24.35;Gelatinase B. 186
  • Metal Site L=Leucine at location 187 on the protein
  • Metal Site Description: Calcium 3; via carbonyl oxygen
GGNSAGE3.4.24.35;Gelatinase B. 339
  • Gene: MMP9
LWCATTSN3.4.24;Metalloendopeptidases. 371
  • Domain: Fibronectin type-II
KWGFCPD3.4.24;Metalloendopeptidases. 384
  • Domain: Fibronectin type-II
LFLVAAHE3.4.24;Metalloendopeptidases. 395
  • Metal Site H=Histidine at location 401 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
VAAHEFGH3.4.24;Metalloendopeptidases. 398
  • Active Site E=Glutamic acid at location 402 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 401 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
VAAHEFGHALGL3.4.24.35;Gelatinase B. 398
  • Active Site E=Glutamic acid at location 402 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 401 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
IGNQLYL3.4.24.35;Gelatinase B. 527 -
FFFSGRQ3.4.24.35;Gelatinase B. 580
  • Domain: Hemopexin-like
  • Gene: MMP9
LDKLGLG3.4.24.35;Gelatinase B. 601
  • Domain: Hemopexin-like
  • Gene: MMP9

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCG
VPD
LGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQG
DAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVM
GGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAA
HEFGHALGL
DHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAG
PSTATTVPLSPVDDACNVNIFDAIAE
IGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYD
ILQCPED



DME EC Prediction for this protein is: 3.4.24.35
Check another protein