Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
AAMADTFLEH2.7.1.40;Pyruvate kinase. 20 -
LEHMCRL2.7.1.40;Pyruvate kinase. 27 -
GPASRSV2.7.1.40;Pyruvate kinase. 52 -
RLNFSHG2.7.1.40;Pyruvate kinase. 73 -
NFSHGTH2.7.1.40;Pyruvate kinase. 75 -
ATESFASDPI2.7.1.40;Pyruvate kinase. 94 -
LDTKGPEIR2.7.1.40;Pyruvate kinase. 112
  • Metal Site D=Aspartic acid at location 113 on the protein
  • Metal Site Description: Potassium (By similarity).
LWLDYKNICKVVEVGSK2.7.1.40;Pyruvate kinase. 157
  • Gene: KPYM
DDGLISL2.7.1.40;Pyruvate kinase. 177 -
TEVENGG2.7.1.40;Pyruvate kinase. 195 -
EVENGGSLGS2.7.1.40;Pyruvate kinase. 196 -
GSKKGVN2.7.1.40;Pyruvate kinase. 204 -
KGVNLPG2.7.1.40;Pyruvate kinase. 207 -
VDLPAVS2.7.1.40;Pyruvate kinase. 216 -
VDMVFASFIR2.7.1.40;Pyruvate kinase. 237 -
IKIISKIE2.7.1.40;Pyruvate kinase. 265
  • Active Site K=Lysine at location 270 on the protein
  • Active Site Description: By similarity.
SDGIMVARGD2.7.1.40;Pyruvate kinase. 287
  • Metal Site A=Alanine at location 293 on the protein
  • Metal Site Description: Magnesium (By similarity).
MVARGDLG2.7.1.40;Pyruvate kinase. 291
  • Metal Site A=Alanine at location 293 on the protein
  • Metal Site Description: Magnesium (By similarity).
EIPAEKV2.7.1.40;Pyruvate kinase. 300 -
ICATQMLESM2.7.1.40;Pyruvate kinase. 325 -
ATQMLESMI2.7.1.40;Pyruvate kinase. 327 -
PRPTRAE2.7.1.40;Pyruvate kinase. 338 -
VANAVLDG2.7.1.40;Pyruvate kinase. 348 -
NAVLDGAD2.7.1.40;Pyruvate kinase. 350 -
MLSGETA2.7.1.40;Pyruvate kinase. 360 -
IAREAEAA2.7.1.40;Pyruvate kinase. 381 -
GAVEASFKC2.7.1.40;Pyruvate kinase. 415 -
RYRPRAPIIAVTRN2.7.1.40;Pyruvate kinase. 443 -
QTARQAHLYRG2.7.1.40;Pyruvate kinase. 458 -
GKARGFFK2.7.1.40;Pyruvate kinase. 497 -
TGWRPGSG2.7.1.40;Pyruvate kinase. 513 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFAS
DPI
LYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENG
GSLGSKKGVNLPG
AAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKV
FLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRR
LAPITSDPTEATAV
GAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKAR
GFFK
KGDVVIVLTGWRPGSGFTNTMRVVPVP



DME EC Prediction for this protein is: 2.7.1.40
Check another protein