Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
MPLIGLGT1.1.1.2;Alcohol dehydrogenase (NADP(+)). 14 -
GLGTWKS1.1.1;With NAD(+) or NADP(+) as acceptor. 18 -
GYRHIDCA1.1.1;With NAD(+) or NADP(+) as acceptor. 40
  • Binding Site D=Aspartic acid at location 45 on the protein
  • Binding site description: NADP.
AAIYGNE1.1.1;With NAD(+) or NADP(+) as acceptor. 47
  • Active Site Y=Tyrosine at location 50 on the protein
  • Active Site Description: Proton donor (By similarity).
DLYLMHWP1.1.1;With NAD(+) or NADP(+) as acceptor. 108
  • Binding Site H=Histidine at location 113 on the protein
  • Binding site description: Substrate (By similarity).
ALEALVAKGLV1.1.1.2;Alcohol dehydrogenase (NADP(+)). 146
  • Gene: AK1A1
VTAYSPLGS1.1.1;With NAD(+) or NADP(+) as acceptor. 207 -
PDEPVLLEEPVVLALAEK1.1.1.2;Alcohol dehydrogenase (NADP(+)). 223
  • Gene: AK1A1
RSPAQILLRWQVQRKVICIPKS1.1.1.2;Alcohol dehydrogenase (NADP(+)). 243
  • Gene: AK1A1
VFDFTFSPEEMKQL1.1.1.2;Alcohol dehydrogenase (NADP(+)). 276
  • Gene: AK1A1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLA
DLQLEYL
DLYLMHWPYAFERGDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHC
QARGLE
VTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIV
PMLTVDGKRVPRDAGHPLYPFNDPY



DME EC Prediction for this protein is: 1.1.1.2
Check another protein