Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QSVLHSGYFHPLLR4.2.1.24;Porphobilinogen synthase. 4
  • Gene: HEM2
LIYPIFV4.2.1.24;Porphobilinogen synthase. 31
  • Gene: HEM2
SLPGVARYGV4.2.1.24;Porphobilinogen synthase. 49
  • Gene: HEM2
LEEMLRPLVE4.2.1.24;Porphobilinogen synthase. 61
  • Gene: HEM2
LLRKTFP4.2.1.24;Porphobilinogen synthase. 107
  • Gene: HEM2
YTSHGHCG4.2.1.24;Porphobilinogen synthase. 126
  • Metal Site C=Cysteine at location 132 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Gene: HEM2
PSDMMDGR4.2.1.24;Porphobilinogen synthase. 167
  • Gene: HEM2
YSAKFAS4.2.1.24;Porphobilinogen synthase. 196
  • Gene: HEM2
GPFRDAA4.2.1.24;Porphobilinogen synthase. 206
  • Gene: HEM2
MVKPGMPYLD4.2.1.24;Porphobilinogen synthase. 250
  • Active Site K=Lysine at location 252 on the protein
  • Active Site Description: By similarity.
  • Gene: HEM2
VSGEFAMLWHGA4.2.1.24;Porphobilinogen synthase. 278
  • Gene: HEM2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKRLEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESP
AIEAIH
LLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKF
AS
CFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAV
LEAMTAFRRAGADIIITYYTPQLLQWLKEE



DME EC Prediction for this protein is: 4.2.1.24
Check another protein