Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LRFVAVGDWGGVPNAPFHTAREMANAK3.1.3.2;Acid phosphatase. 26
  • Metal Site D=Aspartic acid at location 33 on the protein
  • Metal Site Description: Iron 1 (By similarity).
  • Gene: PPA5
DKRFQETFEDVFSD3.1.3.2;Acid phosphatase. 83
  • Gene: PPA5
GNVSAQIAYSK3.1.3.2;Acid phosphatase. 115
  • Gene: PPA5
SKRWNFPSP3.1.3.2;Acid phosphatase. 127
  • Gene: PPA5
WSIAEHGPT3.1.3.2;Acid phosphatase. 209
  • Gene: PPA5
VTAYLCGHDHNLQYLQDENG3.1.3.2;Acid phosphatase. 233
  • Metal Site H=Histidine at location 240 on the protein
  • Metal Site Description: Iron 2 (By similarity).
  • Gene: PPA5
VLSGAGNFMDPS3.1.3.2;Acid phosphatase. 256
  • Gene: PPA5
EASGKSLFKT3.1.3.2;Acid phosphatase. 308
  • Gene: PPA5

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLGDNFYFTGVQDINDKRFQETFEDVFSDRSLR
KVPWYVLAGNHDHL
GNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYV
LVAGHYPV
WSIAEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVEISSK
EMTVTYI
EASGKSLFKTRLPRRARP



DME EC Prediction for this protein is: 3.1.3.2
Check another protein