Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QHRKLLTPGFHYDVLKPYVA1.14.14.1;Unspecific monooxygenase. 136
  • Gene: CP4B1
TLMKCTFG1.14.14.1;Unspecific monooxygenase. 191
  • Gene: CP4B1
VWPDPEVFD1.14.14.1;Unspecific monooxygenase. 418 -
GPRNCIGQQFAM1.14.14.1;Unspecific monooxygenase. 449
  • Metal Site C=Cysteine at location 453 on the protein
  • Metal Site Description: Iron (heme axial ligand) (By s

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKVVSWAHQFPYAHPLWFGQFIGFLNIYEPDYA
KAVYSRGDPKAPDVYDFFLQWIGRGLLVLEGPKWL
QHRKLLTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRG
DTGLGHRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDIKL
SDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLP
AGSLISMHIYALHRNSA
VWPDPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQLVLRSKNGFHL
HLKPLGPGSGK



DME EC Prediction for this protein is: 1.14.14.1
Check another protein