Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SQRRRSLEP2.7.10.2;Non-specific protein-tyrosine kinase. 12
  • Gene: SRC
EPKLFGGFN2.7.10.2;Non-specific protein-tyrosine kinase. 60
  • Gene: SRC
SDTVTSPQRAG2.7.10.2;Non-specific protein-tyrosine kinase. 70
  • Gene: SRC
FVALYDYE2.7.10.2;Non-specific protein-tyrosine kinase. 89
  • Domain: SH3
DLSFKKG2.7.10.2;Non-specific protein-tyrosine kinase. 102
  • Domain: SH3
GYIPSNYVA2.7.10.2;Non-specific protein-tyrosine kinase. 133
  • Domain: SH3
DSIQAEEWY2.7.10.2;Non-specific protein-tyrosine kinase. 144
  • Domain: SH3
GKITRRE2.7.10.2;Non-specific protein-tyrosine kinase. 154
  • Domain: SH2
ENPRGTFLVR2.7.10.2;Non-specific protein-tyrosine kinase. 169
  • Domain: SH2
RESETTKGA2.7.10.2;Non-specific protein-tyrosine kinase. 178
  • Domain: SH2
VKHYKIR2.7.10.2;Non-specific protein-tyrosine kinase. 202
  • Domain: SH2
KHYKIRKLD2.7.10.2;Non-specific protein-tyrosine kinase. 203
  • Domain: SH2
SGGFYITSRTQF2.7.10.2;Non-specific protein-tyrosine kinase. 212
  • Domain: SH2
SLQQLVAYYSKHADGLCHRL2.7.10.2;Non-specific protein-tyrosine kinase. 225
  • Domain: SH2
DAWEIPR2.7.10.2;Non-specific protein-tyrosine kinase. 261 -
FGEVWMGTWN2.7.10.2;Non-specific protein-tyrosine kinase. 281
  • Domain: Protein kinase
GTWNGTT2.7.10.2;Non-specific protein-tyrosine kinase. 287
  • Domain: Protein kinase
KTLKPGTM2.7.10.2;Non-specific protein-tyrosine kinase. 298
  • Binding Site K=Lysine at location 298 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
GTMSPEAFL2.7.10.2;Non-specific protein-tyrosine kinase. 303
  • Domain: Protein kinase
PEAFLQEAQ2.7.10.2;Non-specific protein-tyrosine kinase. 307
  • Domain: Protein kinase
QEAQVMKK2.7.10.2;Non-specific protein-tyrosine kinase. 312
  • Domain: Protein kinase
HEKLVQLY2.7.10.2;Non-specific protein-tyrosine kinase. 322
  • Domain: Protein kinase
KLVQLYAVV2.7.10.2;Non-specific protein-tyrosine kinase. 324
  • Domain: Protein kinase
VSEEPIYIV2.7.10.2;Non-specific protein-tyrosine kinase. 332
  • Domain: Protein kinase
PIYIVTE2.7.10.2;Non-specific protein-tyrosine kinase. 336
  • Domain: Protein kinase
KGSLLDFLK2.7.10.2;Non-specific protein-tyrosine kinase. 346
  • Domain: Protein kinase
LPQLVDM2.7.10.2;Non-specific protein-tyrosine kinase. 363
  • Domain: Protein kinase
DMAAQIA2.7.10.2;Non-specific protein-tyrosine kinase. 368
  • Domain: Protein kinase
AQIASGMAYV2.7.10.2;Non-specific protein-tyrosine kinase. 371
  • Domain: Protein kinase
HRDLRAANILV2.7.10.2;Non-specific protein-tyrosine kinase. 387
  • Active Site D=Aspartic acid at location 389 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
ADFGLARLIED2.7.10.2;Non-specific protein-tyrosine kinase. 406
  • Domain: Protein kinase
KFPIKWTAPE2.7.10.2;Non-specific protein-tyrosine kinase. 426
  • Domain: Protein kinase
KWTAPEA2.7.10.2;Non-specific protein-tyrosine kinase. 430
  • Domain: Protein kinase
FTIKSDVWSFG2.7.10.2;Non-specific protein-tyrosine kinase. 442
  • Domain: Protein kinase
IKSDVWSFGILL2.7.10.2;Non-specific protein-tyrosine kinase. 444
  • Domain: Protein kinase
KSDVWSFG2.7.10;Protein-tyrosine kinases. 445
  • Domain: Protein kinase
KGRVPYPGM2.7.10.2;Non-specific protein-tyrosine kinase. 461
  • Domain: Protein kinase
RGYRMPCP2.7.10.2;Non-specific protein-tyrosine kinase. 480
  • Domain: Protein kinase
PEERPTFE2.7.10.2;Non-specific protein-tyrosine kinase. 506
  • Domain: Protein kinase
FLEDYFT2.7.10.2;Non-specific protein-tyrosine kinase. 518
  • Domain: Protein kinase
EPQYQPG2.7.10.2;Non-specific protein-tyrosine kinase. 527 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTE
T
DLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGL
N
VKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKK
LRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGEN
LVCKV
ADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQ
CWRKE
PEERPTFEYLQAFLEDYFTSTEPQYQPGENL



DME EC Prediction for this protein is: 2.7.10.2
Check another protein