Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SLDDKPQFPGASAEF1.2.4.4;3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring). 47
  • Gene: ODBA
SMTLLNTMDRILYESQR1.2.4.4;3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring). 108
  • Gene: ODBA
GRISFYMTNYGEEGTHVGSAAAL1.2.4.4;3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring). 126
  • Gene: ODBA
TDLVFGQYREAGVLMYRDYPLELFM1.2.4.4;3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring). 151
  • Gene: ODBA
YFGEGAASEGD1.2.4.4;3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring). 235
  • Gene: ODBA
SIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRI1.2.4.4;3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring). 295
  • Gene: ODBA
GHHSTSDDSS1.2.4.4;3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring). 334
  • Gene: ODBA
KVMEAFEQAERK1.2.4.4;3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring). 389
  • Gene: ODBA
QQESLARHLQTYGEHYPLDHF1.2.4.4;3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring). 423
  • Gene: ODBA

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAVAIAAARVWRLNRGLSQAALLLLRQPGARGLARSHPPRQQQQFSSLDDKPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKE
KVLKLYK
SMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKER
HFVTISSPLATQIPQAVGAAYAAKRANANRVVIC
YFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDG
NDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSS
AYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERK
PKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK



DME EC Prediction for this protein is: 1.2.4.4
Check another protein