Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
YEPVAEIGVGAYGTVYKARD2.7.11.22;Cyclin-dependent kinase. 6
  • Domain: Protein kinase
  • Gene: CDK4
HPNVVRL2.7.11;Protein-serine/threonine kinases. 68
  • Domain: Protein kinase
TLVFEHVDQDL2.7.11.22;Cyclin-dependent kinase. 90
  • Domain: Protein kinase
ETIKDLM2.7.11.22;Cyclin-dependent kinase. 115
  • Domain: Protein kinase
  • Gene: CDK4
IVHRDLK2.7.11;Protein-serine/threonine kinases. 136
  • Active Site R=Arginine at location 139 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
VHRDLKP2.7.11;Protein-serine/threonine kinases. 137
  • Active Site R=Arginine at location 139 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLKPEN2.7.11;Protein-serine/threonine kinases. 139
  • Active Site D=Aspartic acid at location 140 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
ENILVTS2.7.11;Protein-serine/threonine kinases. 144
  • Domain: Protein kinase
VKLADFG2.7.11;Protein-serine/threonine kinases. 154
  • Domain: Protein kinase
LADFGLA2.7.11;Protein-serine/threonine kinases. 156
  • Binding Site D=Aspartic acid at location 158 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
QMALTPVVVTLWYRAPEVLLQSTYATPVD2.7.11.22;Cyclin-dependent kinase. 168
  • Domain: Protein kinase
  • Gene: CDK4
VVTLWYR2.7.11;Protein-serine/threonine kinases. 175
  • Domain: Protein kinase
WSVGCIFAE2.7.11;Protein-serine/threonine kinases. 198
  • Domain: Protein kinase
WSVGCIFAEMFRRKPLF2.7.11.22;Cyclin-dependent kinase. 198
  • Domain: Protein kinase
GCIFAEM2.7.11;Protein-serine/threonine kinases. 201
  • Domain: Protein kinase
RKPLFCGNSEADQL2.7.11.22;Cyclin-dependent kinase. 210
  • Domain: Protein kinase
  • Gene: CDK4
KRISAFRALQHSYLHK2.7.11.22;Cyclin-dependent kinase. 282
  • Domain: Protein kinase
  • Gene: CDK4

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDL
RTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSV
GCIFAEMFRRKPLFCGNSEADQL
GKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE



DME EC Prediction for this protein is: 2.7.11.22
Check another protein