Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
WEAGKPL1.1.1.1;Alcohol dehydrogenase. 14 -
EVAPPKA1.1.1.1;Alcohol dehydrogenase. 26 -
PVILGHE1.1.1;With NAD(+) or NADP(+) as acceptor. 62
  • Metal Site H=Histidine at location 67 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
LGHEGAGIVES1.1.1.1;Alcohol dehydrogenase. 65
  • Metal Site H=Histidine at location 67 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
GIVESVG1.1.1.1;Alcohol dehydrogenase. 71 -
ESVGEGVT1.1.1.1;Alcohol dehydrogenase. 74 -
RFTCKGK1.1.1.1;Alcohol dehydrogenase. 129 -
TFSEYTV1.1.1.1;Alcohol dehydrogenase. 145 -
APLDKVC1.1.1.1;Alcohol dehydrogenase. 164 -
AGASRII1.1.1;With NAD(+) or NADP(+) as acceptor. 214 -
DINKDKF1.1.1.1;Alcohol dehydrogenase. 223
  • Binding Site D=Aspartic acid at location 223 on the protein
  • Binding site description: NAD (By similarity).
GATECINP1.1.1.1;Alcohol dehydrogenase. 236 -
KPIQEVL1.1.1.1;Alcohol dehydrogenase. 248 -
EMTDGGV1.1.1.1;Alcohol dehydrogenase. 256 -
GVDYSFE1.1.1.1;Alcohol dehydrogenase. 261 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGEC
KFCLNPKTNLCQKIRVTQGKGLMPDGTS
RFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGL
GGVGLAVIMGCKV
AGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEE
IATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVVKI



DME EC Prediction for this protein is: 1.1.1.1
Check another protein