Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LLVWNYE1.14.14.1;Unspecific monooxygenase. 36
  • Gene: CP19A
TSSIPGP1.14.14.1;Unspecific monooxygenase. 44 -
GIGPLIS1.14.14.1;Unspecific monooxygenase. 55 -
RFLWMGIGS1.14.14.1;Unspecific monooxygenase. 64 -
RVWISGEET1.14.14.1;Unspecific monooxygenase. 86 -
GEETLIISKSSS1.14.14.1;Unspecific monooxygenase. 91 -
RFGSKLGL1.14.14.1;Unspecific monooxygenase. 115 -
GLQCIGMHE1.14.14.1;Unspecific monooxygenase. 121 -
IGMHEKGI1.14.14.1;Unspecific monooxygenase. 125 -
GIIFNNNP1.14.14.1;Unspecific monooxygenase. 131 -
RPFFMKAL1.14.14.1;Unspecific monooxygenase. 145
  • Gene: CP19A
GPGLVRMV1.14.14.1;Unspecific monooxygenase. 154 -
IFFKISWL1.14.14.1;Unspecific monooxygenase. 233 -
KYEKSVKDLKDA1.14.14.1;Unspecific monooxygenase. 243 -
DFATELI1.14.14.1;Unspecific monooxygenase. 277 -
FFMLFLIAKHP1.14.14.1;Unspecific monooxygenase. 316 -
ESMRYQPVVD1.14.14.1;Unspecific monooxygenase. 362 -
RYQPVVDLVMR1.14.14.1;Unspecific monooxygenase. 365 -
LVMRKAL1.14.14.1;Unspecific monooxygenase. 372 -
GTNIILN1.14.14.1;Unspecific monooxygenase. 391 -
ILNIGRMH1.14.14.1;Unspecific monooxygenase. 395 -
FPKPNEFTLENF1.14.14.1;Unspecific monooxygenase. 407 -
RYFQPFG1.14.14.1;Unspecific monooxygenase. 425 -
PFGFGPR1.14.14.1;Unspecific monooxygenase. 429 -
IAMVMMK1.14.14.1;Unspecific monooxygenase. 442 -
LSLHPDET1.14.14.1;Unspecific monooxygenase. 477 -
MIFTPRNS1.14.14.1;Unspecific monooxygenase. 490
  • Gene: CP19A

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKS
SS
MFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSN
TLFLRIPLDESAIVVKIQGYFDAWQALLIKPD
IFFKISWLYKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSL
FFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGR
MH
RLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLHPDETKNMLEMIFTPRNSDRC
LEH



DME EC Prediction for this protein is: 1.14.14.1
Check another protein