Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QLEHILLRPD5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 39 -
RPDTYIGSVE5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 46 -
VTQQMWV5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 57
  • Gene: TOP2A
MWVYDEDVG5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 61 -
VNAADNK5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 90
  • Binding Site N=Asparagine at location 91 on the protein
  • Binding site description: ATP (By similarity).
NNGKGIP5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 120
  • Binding Site N=Asparagine at location 120 on the protein
  • Binding site description: ATP (By similarity).
LLTSSNY5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 145 -
TSSNYDD5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 147 -
KVTGGRNGYGAKLCNIFST5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 157 -
NIFSTKF5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 171 -
PDLSKFKM5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 221 -
LDKDIVALM5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 231 -
RRAYDIAGSTKDVKVFLNG5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 241
  • Gene: TOP2A
VFLNGNKL5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 255 -
KDKLDETG5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 276 -
RWEVCLT5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 296
  • Gene: TOP2A
SFVNSIAT5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 312 -
KGGRHVD5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 321 -
VVKKKNK5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 340 -
KKKNKGG5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 342 -
QVKNHMWIF5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 355
  • Gene: TOP2A
FDSQTKE5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 373
  • Binding Site K=Lysine at location 378 on the protein
  • Binding site description: ATP (By similarity).
ESILNWVKFKAQ5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 409 -
QLNKKCS5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 422 -
CTLILTEG5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 455 -
GVFPLRGK5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 482 -
ENAEINN5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 503 -
KTLRYGK5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 529 -
MIMTDQD5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 537 -
DGSHIKGL5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 545 -
INFIHHNWP5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 554 -
FLEEFITPI5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 569 -
EFITPIVK5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 572 -
AFYSLPEFEEWKS5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 588
  • Gene: TOP2A
KYYKGLGTS5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 611 -
KEYFADM5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 625 -
GPEDDAAI5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 642 -
DDRKEWL5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 659 -
FMEDRRQR5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 668 -
GLPEDYLYG5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 679
  • Gene: TOP2A
DNERSIP5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 710 -
KPGQRKVL5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 723 -
VGSNNLNLL5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 776 -
NLLQPIGQFGTRLHGGKD5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 782 -
ASPRYIF5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 801
  • Active Site Y=Tyrosine at location 805 on the protein
  • Active Site Description: O-(5'-phospho-DNA)-tyrosine in
LARLLFP5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 813 -
FLYDDNQRVEPEWY5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 828 -
PIIPMVL5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 843 -
NGAEGIGTG5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 851 -
YKEQVLEPMLNGTEKTP5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 935 -
EYHTDTTV5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 959 -
EEKLAEAE5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 974
  • Gene: TOP2A
GLHKVFKLQT5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 984 -
LTCNSMVLFDH5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 995 -
GMLGAES5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 1039 -
NQARFIL5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 1050 -
QARFILEK5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 1051 -
VLIQRGY5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 1076
  • Gene: TOP2A
SDPVKAWKE5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 1084 -
LTKEKKDEL5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 1136 -
EMKAEAEK5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 1226
  • Gene: TOP2A
KRNPWSD5.99.1.3;DNA topoisomerase (ATP-hydrolyzing). 1290 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDP
KMSCIRVTIDPENNLISIW
NNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGR
AGEMELKPFNGEDYTCITFQ
PDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVC
LT
MSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHMWIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIK
AAIGCGIV
ESILNWVKFKAQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQ
IM
ENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKS
STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFIN
KELILFSNS
DNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDS
ASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIE
ELAPNQYVISGEVAILNSTTIEISELPVRTWTQT
YKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSM
VLFDH
VGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDE
EENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWY
LTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA
KGKKTQMAEVLPSPRGQRVIPRITI
EMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQRLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESD
RSSDESNFDVPPRETEPRRAATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFP
DETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHM
DFDSAVAPRAKSVRAKKPIKYLEESDEDDLF



DME EC Prediction for this protein is: 5.99.1.3
Check another protein