Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
WRSQHTK1.3.99.3;Acyl-CoA dehydrogenase. 20
  • Gene: ACADM
EPGLGFSFE1.3.99.3;Acyl-CoA dehydrogenase. 32
  • Gene: ACADM
GFSFEFTEQQKEFQATARKFAREEIIP1.3.99.3;Acyl-CoA dehydrogenase. 36
  • Gene: ACADM
TEQQKEFQATARKFAREEIIPVAAEYD1.3.99.3;Acyl-CoA dehydrogenase. 42
  • Gene: ACADM
AAEYDKTGEYPVPLI1.3.99.3;Acyl-CoA dehydrogenase. 64
  • Gene: ACADM
AWELGLMN1.3.99.3;Acyl-CoA dehydrogenase. 81
  • Gene: ACADM
CGGLGLGTFDACLI1.3.99.3;Acyl-CoA dehydrogenase. 95
  • Gene: ACADM
EELAYGCTG1.3.99.3;Acyl-CoA dehydrogenase. 110
  • Gene: ACADM
QKKKYLG1.3.99.3;Acyl-CoA dehydrogenase. 141
  • Gene: ACADM
KKYLGRMTEEPLMCAYCVTEP1.3.99.3;Acyl-CoA dehydrogenase. 143
  • Gene: ACADM
TEPGAGSD1.3.99;With other acceptors. 161
  • Binding Site S=Serine at location 167 on the protein
  • Binding site description: Substrate; via carbonyl oxygen
TEPGAGSDV1.3.99.3;Acyl-CoA dehydrogenase. 161
  • Binding Site S=Serine at location 167 on the protein
  • Binding site description: Substrate; via carbonyl oxygen
KAEKKGD1.3.99;With other acceptors. 175 -
AEKKGDE1.3.99.3;Acyl-CoA dehydrogenase. 176
  • Gene: ACADM
INGQKMWITNGG1.3.99.3;Acyl-CoA dehydrogenase. 185
  • Gene: ACADM
KMWITNG1.3.99;With other acceptors. 189 -
NMGQRCSDTR1.3.99.3;Acyl-CoA dehydrogenase. 239
  • Gene: ACADM
DSGRRNTYYASIAKA1.3.99.3;Acyl-CoA dehydrogenase. 345
  • Binding Site R=Arginine at location 349 on the protein
  • Binding site description: Substrate.
  • Gene: ACADM
DIANQLATDAVQ1.3.99.3;Acyl-CoA dehydrogenase. 363
  • Gene: ACADM
EYPVEKLMRDAKIYQIYEGT1.3.99.3;Acyl-CoA dehydrogenase. 384
  • Active Site E=Glutamic acid at location 401 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Binding Site G=Glycine at location 402 on the protein
  • Binding site description: Substrate; via amide nitrogen.
  • Gene: ACADM

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGL
GTFDACLI
SEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANW
YFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKEL
NMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEAT
KYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEV
DSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIY
EGT
SQIQRLIVAREHIDKYKN



DME EC Prediction for this protein is: 1.3.99.3
Check another protein