Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GWSRAALLQL3.1.3.2;Acid phosphatase. 7
  • Gene: PPAL
YRHGDRSPV3.1.3.2;Acid phosphatase. 40
  • Active Site H=Histidine at location 42 on the protein
  • Active Site Description: Nucleophile (By similarity).
  • Gene: PPAL
YPKDPYQEE3.1.3.2;Acid phosphatase. 51
  • Gene: PPAL
WPQGFGQLT3.1.3.2;Acid phosphatase. 61 -
RSTDFDRTL3.1.3.2;Acid phosphatase. 103 -
DRTLMSA3.1.3.2;Acid phosphatase. 108 -
ANLAGLFP3.1.3.2;Acid phosphatase. 116 -
WQPIPVHT3.1.3.2;Acid phosphatase. 136 -
EDRLLKFPLGPCPR3.1.3.2;Acid phosphatase. 148
  • Gene: PPAL
EQLQNETR3.1.3.2;Acid phosphatase. 163
  • Gene: PPAL
PEYQNES3.1.3.2;Acid phosphatase. 173
  • Gene: PPAL
NAQFLDMVANETGL3.1.3.2;Acid phosphatase. 182
  • Gene: PPAL
VYDTLFC3.1.3.2;Acid phosphatase. 206 -
LPPWASPQT3.1.3.2;Acid phosphatase. 220
  • Gene: PPAL
RLQGGVL3.1.3.2;Acid phosphatase. 254 -
PKLLVYSAHDTTLVALQMAL3.1.3.2;Acid phosphatase. 278
  • Active Site D=Aspartic acid at location 287 on the protein
  • Active Site Description: Proton donor (By similarity).
  • Gene: PPAL
VYNGEQAPYASCH3.1.3.2;Acid phosphatase. 299
  • Gene: PPAL
GNFSVEMYFRN3.1.3.2;Acid phosphatase. 321
  • Gene: PPAL
ADTEVIVALAVCGSILFLLIVLLLT3.1.3.2;Acid phosphatase. 377
  • Gene: PPAL

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAGKRSGWSRAALLQLLLGVNLVVMPPTRARSLRFVTLLYRHGDRSPVKTYPKDPYQEEEWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEV
YV
RSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTL
ETVWN
VYDTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLPKLLVYSAHDTTLVALQMALDVY
NGEQAPYASCH
IFELYQEDSGNFSVEMYFRNESDKAPWPLSLPGCPHRCPLQDFLRLTEPVVPKDWQQECQLASGPADTEVIVALAVCGSILFLLIVLLL
T
VLFRMQAQPPGYRHVADGEDHA



DME EC Prediction for this protein is: 3.1.3.2
Check another protein