Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FLGDGMGV3.1.3.1;Alkaline phosphatase. 58
  • Metal Site D=Aspartic acid at location 61 on the protein
  • Metal Site Description: Magnesium (By similarity).
GDGMGVSTVTA3.1.3.1;Alkaline phosphatase. 60
  • Metal Site D=Aspartic acid at location 61 on the protein
  • Metal Site Description: Magnesium (Potential).
LAMDRFP3.1.3.1;Alkaline phosphatase. 88 -
TATAYLCGVK3.1.3.1;Alkaline phosphatase. 114 -
SAAARFNQCN3.1.3.1;Alkaline phosphatase. 132 -
TTRGNEV3.1.3.1;Alkaline phosphatase. 142 -
RAKKAGKSVGV3.1.3.1;Alkaline phosphatase. 154 -
GVVTTTR3.1.3.1;Alkaline phosphatase. 163 -
GGGRKYM3.1.3.1;Alkaline phosphatase. 220 -
GTPDPEYP3.1.3.1;Alkaline phosphatase. 230 -
NLVQEWL3.1.3.1;Alkaline phosphatase. 251 -
LMGLFEP3.1.3.1;Alkaline phosphatase. 284 -
GLFEPGD3.1.3.1;Alkaline phosphatase. 286 -
VEGGRID3.1.3.1;Alkaline phosphatase. 329
  • Metal Site E=Glutamic acid at location 330 on the protein
  • Metal Site Description: Magnesium (By similarity).
VTADHSHVF3.1.3.1;Alkaline phosphatase. 373
  • Metal Site D=Aspartic acid at location 376 on the protein
  • Metal Site Description: Zinc 2 (Potential).
LYGNGPGY3.1.3.1;Alkaline phosphatase. 411 -
FARGPQAHL3.1.3.1;Alkaline phosphatase. 459 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSK
TYSVDKHVPDSGA
TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQE
GCQDIATQLISNMDIDVIL
GGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALLLLSRNPRGFFLF
VEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGK
ARDRKAYTVL
LYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPRAG
TTDAAHPGPSVVPALLPLLAGTLLLLGTATAP



DME EC Prediction for this protein is: 3.1.3.1
Check another protein