Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
WVLTAAH3.4.21;Serine endopeptidases. 82
  • Domain: Peptidase S1
VLTAAHC3.4.21;Serine endopeptidases. 83
  • Active Site H=Histidine at location 88 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
LTAAHCF3.4.21;Serine endopeptidases. 84
  • Active Site H=Histidine at location 88 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
LCNSTQWYNGR3.4.21.10;Acrosin. 208
  • Domain: Peptidase S1
  • Gene: ACRO
GKIDTCQGDSGGPLMC3.4.21.10;Acrosin. 231
  • Active Site S=Serine at location 240 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
  • Gene: ACRO
CQGDSGGP3.4.21;Serine endopeptidases. 236
  • Active Site S=Serine at location 240 on the protein
  • Active Site Description: Charge relay system (By simila
  • Binding Site S=Serine at location 240 on the protein
  • Binding site description: Substrate.
  • Domain: Peptidase S1
GDSGGPL3.4.21;Serine endopeptidases. 238
  • Active Site S=Serine at location 240 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
VGITSWG3.4.21;Serine endopeptidases. 257
  • Domain: Peptidase S1
GITSWGVGCARAKRPG3.4.21.10;Acrosin. 258
  • Domain: Peptidase S1
  • Gene: ACRO
WIASKIG3.4.21.10;Acrosin. 284
  • Domain: Peptidase S1
  • Gene: ACRO

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVEMLPTAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSLQIFTYNSHRYHTCGGSLLNSRWVLTAAHCFVGKNNVHDWR
LVFGAKEITYGNNKPVKAPLQERYVEKIIIHEKYNSATEGNDIALVEITPPISCGRFIGPGCLPHFKAGLPRGSQSCWVAGWGYIEEKAPRPSSILMEAR
VDLIDLD
LCNSTQWYNGRVQPTNVCAGYPVGKIDTCQGDSGGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWPYLNWIASKIGSNALRMIQSA
TPPPPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPPPPPPPTPSSTTKLPQGLSFAKRLQQLIEVLKGKTY
SDGKNHYDMETTELPELTSTS



DME EC Prediction for this protein is: 3.4.21.10
Check another protein